x402 web tools

Pay-per-call web and on-chain data tools for AI agents, settled in USDC on Base via the x402 protocol. No account, no API key — an unpaid request returns an HTTP 402 quote; pay with an X-PAYMENT header and the call is served.

Skills

• web-extract
  Fetch any public web page and return its main readable content as clean Markdown or plain text plus metadata (title), stripping nav/ads/boilerplate (trafilatura). Optional JS rendering via headless browser for SPAs; markdown or text output. Robots-respecting, public content only — the reader/scraper building block for RAG and agent pipelines.
  webextractreaderscrapingmarkdownurl-to-markdowncontentragparsereadability
• web-search
  Free-text web search for AI agents: ranked title/url/snippet results fused across multiple engines (Brave, Google, DuckDuckGo, Mojeek, Startpage, Yahoo), with freshness filters (past day/week/month/year), region/locale and SafeSearch. One call for grounded, up-to-date web results — no keys, no scraping setup.
  websearchweb-searchserpresultsgroundingresearchreal-timemulti-engineagents
• web-news
  Keyword news search across web news engines (Bing/DuckDuckGo/Yahoo via ddgs). Returns dated headlines with title/url/snippet/source/image + freshness/region/safesearch filters.
  webnewssearchheadlineslatestcurrent-eventspressfreshsyndication
• onchain-price
  On-chain USD spot price for 50+ assets from Chainlink feeds or the most-liquid Base DEX pool (computed from public chain state): crypto majors, stablecoins, Base-native tokens, forex currencies and precious metals.
  cryptopriceonchainchainlinkdexbasemarket-dataforexfxstablecoinmetalsspot
• onchain-gas
  EVM gas oracle for any major chain - Ethereum, Base, Arbitrum, Optimism, Polygon, BNB, Avalanche: next-block baseFee plus slow, med and fast priority-fee tiers (maxFeePerGas and maxPriorityFeePerGas), read live from chain state in one call. Choose network (default Ethereum). EIP-1559 and legacy handled.
  cryptogasgas-oracleonchainevmethereumbasearbitrumoptimismpolygonbnbavalancheeip1559basefeepriority-feemarket-data
• onchain-market-report
  Rich cross-source market report for 50+ assets (crypto, stablecoins, forex, metals): Chainlink + DEX pools, TVL-weighted VWAP, total pool TVL, recent change and volatility — all computed by us from on-chain state.
  cryptomarket-dataonchainvwaptvlvolatilitybaseforexstablecoinmetals
• onchain-token-meta
  ERC-20 token metadata on Base, Ethereum, Arbitrum, Optimism, Polygon or BNB (default Base): name, symbol, decimals and totalSupply (raw + human), read live from contract state by address.
  cryptoonchainbaseethereummultichainerc20tokenmetadata
• onchain-wallet-balances
  Native-coin balance + ERC-20 token balances (raw + human) for any address on Base, Ethereum, Arbitrum, Optimism, Polygon or BNB (default Base). On Base pass token symbols or 0x addresses (or a default common set); on other networks pass explicit 0x token addresses.
  cryptoonchainbaseethereummultichainwalletbalanceserc20portfolio
• onchain-code
  Is an address a contract or an EOA on Base, Ethereum, Arbitrum, Optimism, Polygon or BNB (default Base)? Returns is_contract, deployed code size in bytes, and the keccak256 code hash (eth_getCode).
  cryptoonchainbaseethereummultichaincontractbytecodeeoa
• onchain-tx
  Look up a transaction by hash on Base, Ethereum, Arbitrum, Optimism, Polygon or BNB (default Base): from/to/value/nonce/gas, block, and receipt fields (status, gasUsed, logs count). Pending/not-found handled.
  cryptoonchainbaseethereummultichaintransactionreceiptexplorer
• onchain-tx-explain
  Plain-language explanation of an EVM transaction by hash across 12 networks: net token movements per participant (ERC-20, ERC-721, ERC-1155, native, WETH), the operation type (swap, transfer, approve, mint, deploy, wrap, and more), protocol labels, gas in native plus USD, and a readable summary.
  cryptoonchaintransactiondecodeexplainevmmulti-chainswaperc20nft
• onchain-resolve
  Basename/ENS resolution on Base: forward name->address (give 'name') or reverse address->name (give 'address', forward-verified against spoofing).
  cryptoonchainbaseidentitybasenameensresolve
• crypto-verify
  Verify an EIP-191 personal_sign or EIP-712 typed-data signature and recover the signer address from public inputs (message + signature). Verification/recovery only — never signs.
  cryptosignatureeip712eip191verifyecrecoveronchain
• crypto-abi
  ABI-encode a function call (selector + args) or encode/decode arbitrary ABI types — build and parse EVM calldata correctly.
  cryptoabiencodedecodecalldataethereum
• crypto-hash
  Compute keccak256/sha256, a 4-byte function selector, an event topic0, or an ENS namehash/labelhash from a string or hex input.
  cryptokeccak256sha256selectornamehashenshash
• crypto-convert
  Convert token units (wei/gwei/ether or arbitrary decimals), between hex and int, and compute/validate an EIP-55 checksummed address.
  cryptounitsweigweietherdecimalseip55checksumconvert
• data-convert
  Pure-compute data format conversion (no network): JSON<->CSV, JSON<->YAML, JSON normalize/minify, Markdown->HTML (sanitized), HTML->Markdown/text, base64/hex, TOML->JSON. Operates only on the supplied data.
  converttransformjsoncsvyamlmarkdownhtmlbase64datacompute
• web-structured
  Structured parse of a public web page: main text, headings, links, tables and rich metadata (description, canonical, lang, Open Graph, Twitter cards, JSON-LD) as separate fields. Browserless, robots.txt-respecting.
  webscrapingstructuredmetadataopengraphjson-ldheadingstableslinkshtml
• web-feed
  Parse an RSS, Atom or JSON Feed URL into a normalized item list (title/link/published/summary/id/author) plus feed-level metadata.
  webfeedrssatomjson-feedsyndicationnews
• web-links
  Extract every link from a public page for crawling agents: de-duplicated absolute URLs with anchor text, internal/external counts, declared feeds and a sitemap hint.
  weblinkscrawlscrapingsitemapfeeddiscovery
• web-sitemap
  Discover and parse a site's sitemap: pass a site root (found via robots.txt or /sitemap.xml) or a direct .xml. Returns URLs with lastmod/priority; handles <sitemapindex> (one level).
  websitemapcrawldiscoveryseourls
• dex-swaps
  Recent DEX swap history + buy/sell flow for a token or pool on Base: per-swap trader/side/amount/price plus a summary (count, buy/sell volume, net flow, largest swaps), decoded by us from public Aerodrome/Uniswap-V3 Swap event logs.
  defidexswapsflowonchainbaseaerodromeuniswapvolumetrading
• dex-trending
  Trending Base DEX pools ranked by recent swap volume and net buy/sell flow over a short window, computed by us from public Aerodrome/Uniswap-V3 Swap event logs.
  defitrendingdexvolumemomentumonchainbasemovers
• enrich-domain
  Enrich a domain / company / email into one aggregated profile from public sources: registration (RDAP/WHOIS age, registrar, expiry, nameservers), DNS (A/AAAA/MX/NS, SPF, DMARC), TLS certificate (issuer, validity, expiry), homepage metadata (title, description, Open Graph, JSON-LD Organization, social links, role contacts) and a tech-stack detection. Each block is null-on-failure (partial, never 500). Business/domain data only — no personal data of individuals.
  enrichmentdomaincompanywhoisrdapdnsssltlstech-stackmetadatadatacompany-datalead-enrichment
• enrich-email
  Validate and classify an email DOMAIN from public DNS: MX hosts + mail-provider, SPF and DMARC policy, plus disposable / free-webmail / role-account flags and a deliverability signal. No SMTP probing of individual mailboxes (privacy + ToS).
  enrichmentemailvalidationmxspfdmarcdeliverabilitydisposabledataemail-verification
• dev-github-repo
  GitHub repository health & intelligence for due-diligence / dependency choice: stars, forks, open issues, watchers, size, language, topics, license, archived/fork flags, and computed signals (days_since_push, age, issues_per_star, is_active). From the official GitHub REST API, normalized.
  devgithubossrepositorystarsdue-diligencecompetitive-analysisopen-sourcehealth
• dev-package-stats
  Package intelligence across npm / PyPI / crates: latest version, age, release cadence, deprecation/yank, license, and download stats (last day/week/month) with a rising/falling trend. Aggregates the official registry + downloads API + deps.dev.
  devpackagenpmpypicratesdownloadsdependenciesdue-diligencesupply-chainmaintenanceoss
• dev-hn-sentiment
  Hacker News engagement / dev-sentiment for a project or topic: story count, total & average points and comments, and the top stories (title/url/points/comments/date). From the keyless HN Algolia search API.
  devhackernewshnsentimentengagementbuzzcompetitive-analysissocialnews
• dev-github-trending
  Top GitHub repositories by language and/or topic (optionally newer than a date), ranked by stars/forks/recently-updated: name, full_name, stars, language, description, url, pushed_at. From the official GitHub Search API.
  devgithubtrendingossdiscoverycompetitive-analysisopen-sourcetopiclanguagesearch
• geocode
  Forward-geocode a street address or place name (WORLDWIDE) to coordinates + parsed address components via OpenStreetMap Nominatim (public, keyless).
  geogeocodeaddresslocationosmglobal
• geocode-reverse
  Reverse-geocode coordinates (WORLDWIDE) to a street address + parsed components via OpenStreetMap Nominatim; enriched with the nearest NWS city/state when the point is in the US.
  geogeocodereverselocationosmglobal
• us-weather
  Current US weather conditions (temp in C+F, humidity, wind, pressure, description) from the NWS for coordinates OR a US address (auto-geocoded).
  weathergeousconditionsnws
• us-forecast
  Official US weather forecast from the National Weather Service (NOAA): multi-day and hourly periods for any US coordinates or street address. Temperature in Celsius and Fahrenheit, precipitation probability, wind speed and direction, and plain-language conditions. Authoritative government public-domain data, commercial use OK.
  weatherforecastusnwsnoaatemperatureprecipitationrainwindhourlydailymeteorologynational-weather-service
• crypto-news
  Aggregated crypto news with sentiment: deduplicated headlines from many major crypto outlets (CoinDesk, Cointelegraph, Decrypt, Bitcoin Magazine, The Block, CryptoSlate), each scored bullish/bearish/neutral by a crypto-tuned lexicon, optionally filtered by coin or query. One call instead of polling a dozen feeds and running your own NLP.
  cryptonewssentimentbitcoinethereumheadlinesaggregatorrsstradingresearchmarket
• Crypto Fear & Greed Index
  Crypto Fear & Greed Index: the market Fear & Greed value, classification and trend, blended with aggregated crypto news-headline sentiment into one bullish/bearish/neutral score, optionally focused on a coin or query. Data by alternative.me (attributed) + curated RSS headlines.
  crypto fear and greed indexfear and greed indexcryptosentimentfear-greedmarketbitcoinethereumtradingsignalmood
• crypto-sent-ctl
  Composite crypto market sentiment: the Fear & Greed index (value, classification, trend) blended with aggregated news-headline sentiment into one bullish/bearish/neutral score, optionally focused on a coin or query. Data by alternative.me (attributed) + curated RSS headlines.
  cryptosentimentfear-greedmarketbitcoinethereumtradingsignalindexmood
• Crypto Fear & Greed Index
  Composite crypto market sentiment: the Fear & Greed index (value, classification, trend) blended with aggregated news-headline sentiment into one bullish/bearish/neutral score, optionally focused on a coin or query. Data by alternative.me (attributed) + curated RSS headlines.
  cryptosentimentfear-greedmarketbitcoinethereumtradingsignalindexmood
• crypto-sent-desc
  Crypto Fear & Greed Index: the market Fear & Greed value, classification and trend, blended with aggregated crypto news-headline sentiment into one bullish/bearish/neutral score, optionally focused on a coin or query. Data by alternative.me (attributed) + curated RSS headlines.
  cryptosentimentfear-greedmarketbitcoinethereumtradingsignalindexmood
• crypto-sent-tags
  Composite crypto market sentiment: the Fear & Greed index (value, classification, trend) blended with aggregated news-headline sentiment into one bullish/bearish/neutral score, optionally focused on a coin or query. Data by alternative.me (attributed) + curated RSS headlines.
  cryptosentimentfear-greedcrypto fear and greed indexfear and greed indexmarketbitcoinethereumtradingsignalindexmood
• token-risk
  Composite rug-check risk score for an ERC-20 token: a 0-100 score, a category (low/medium/high/critical), per-dimension flags, reasons and weighted signals. Scored deterministically across six dimensions — contract integrity, ownership, holder concentration, liquidity, honeypot and age. Multi-chain EVM. Automated risk indicators, not financial advice.
  cryptotokenriskrug-checkhoneypotsecurityerc20onchain
• sanctions-screen-address
  Check whether a crypto address appears on the official public sanctions lists (OFAC SDN, UK, EU, UN). Deterministic exact lookup; returns the matched record (list, program, entity name, reference, currency).
  sanctionscompliancescreeningcryptoaddressofacamlrisk
• sanctions-screen-entity
  Fuzzy-screen a person or organization name against the official public sanctions lists (OFAC SDN, UK, EU, UN), including aliases. Returns scored matches with list, program, country, type, and reference.
  sanctionscompliancescreeningentitynameamlkycofacrisk
• endpoint-preflight
  Preflight trust check of another x402 endpoint before an agent pays it. From the target resource URL: a composite trust score 0-100, a category (trusted / caution / untrusted / unknown), per-dimension flags, reasons and weighted signals. Scored from CDP x402 Bazaar discovery, an on-chain USDC payment-diversity sample, and a live 402 probe that the served payTo matches the listing. Trust indicators, not a guarantee.
  x402trustpreflightreputationdiscoverybazaarpaymentsanti-scam
• mcp-scan
  Static security scan of an MCP manifest or tool list. Detects tool poisoning, hidden unicode instructions, prompt injection, data-exfiltration directives, dangerous capabilities, tool shadowing and post-approval rug-pull drift. Returns a 0-100 risk score, category, per-tool findings and content hashes. Security indicators, not a guarantee.
  mcpsecuritytool-poisoningprompt-injectionscanneragentsafety
• mcp-inspect
  Static security scan of a single text or prompt blob: hidden unicode, prompt injection, data-exfiltration directives, dangerous-capability and tool-shadowing language, and obfuscation. Returns a 0-100 risk score, category and findings. Security indicators, not a guarantee.
  mcpsecurityprompt-injectiontextscanneragentsafety
• entity-resolve
  Resolve one legal entity across three public registries from a single identifier. Give exactly one of name, ticker, cik, lei, qid or isin and get back the reconciled set of ids (SEC CIK, GLEIF LEI, Wikidata QID, ISIN, ticker, EIN) plus legal name, jurisdiction and status, with per-id provenance and an optional GLEIF parent/child hierarchy.
  entityresolutioncompanycikleiqidisinsecgleifwikidatakybcomplianceidentifiersreconciliationreference-data
• entity-search
  Disambiguate a company by name: fuzzy legal-name search returning ranked candidates, each with the ids known for it (Wikidata QID, GLEIF LEI, SEC CIK, ticker), country and a match score. Cheaper first step before entity/resolve.
  entitysearchcompanynamedisambiguationleicikqidsecgleifwikidatakybreference-data
• edgar-financials
  Normalized company financials from SEC EDGAR XBRL filings. Give a ticker or CIK and get income statement, balance sheet and cash flow lines mapped to one clean schema, each value cited to its real XBRL tag and filing. Compact cited JSON instead of megabytes of raw XBRL.
  financialsxbrlsecedgarfundamentals10-k10-qincome-statementbalance-sheetcash-flowdue-diligencecikticker
• edgar-concept
  Cited time-series for a single financial line-item from SEC EDGAR XBRL. Give a ticker or CIK plus a concept (a canonical name like revenue or netIncome, or a raw us-gaap tag) and get the normalized period values, each cited to its filing. Cheap granular pull.
  financialsxbrlsecedgarconcepttime-seriesfundamentalscikticker
• edgar-ratios
  Key financial ratios computed from SEC EDGAR XBRL: margins, liquidity, leverage and growth. Give a ticker or CIK and get ratios over recent periods, each computed number citing the source facts it was derived from, plus restatement flags and simple anomaly flags.
  ratiosmarginsliquidityleveragegrowthrestatementfundamentalssecedgarxbrldue-diligence
• kyb-screen
  Screen a company name against the GLEIF business registry: fuzzy name search returning ranked candidates, each with its LEI, legal name, jurisdiction, registration status and corroboration level. Cheap first step before kyb/verify.
  kybbusinessverificationcompanyscreeningleigleifdue-diligencecomplianceonboardinglegitimacy
• kyb-verify
  Verify a business is real and get a legitimacy verdict plus a 0-100 risk score. Give one of name, lei, cik, ticker, isin or qid and get a verdict (real, likely_real, inactive, dissolved or not_found), a risk category, per-dimension flags, reasons, the official registry and which registries corroborated. Deterministic scoring, no LLM. Legitimacy indicators, not legal or credit advice.
  kybbusinessverificationlegitimacyriskdue-diligencecomplianceonboardinganti-fraudshell-companyleigleifseccompany
• legal-litigation
  Find US court cases, opinions and dockets naming a business entity. Returns normalized records with case name, court, date, citation, docket number and nature of suit, plus a total count. Source: CourtListener, public-domain.
  legallitigationcourtlawsuitopiniondocketdue-diligencecompliancecourtlistenerpublic-records
• legal-patents
  Look up the US patent portfolio of an organization (by assignee) or an inventor (by name). Returns granted patents with id, title, grant date, type and assignees, plus a total count. Source: USPTO PatentsView, public-domain.
  legalpatentsipusptoassigneeinventordue-diligenceinnovationpatentsviewpublic-records
• legal-regulatory
  Find US federal regulatory and enforcement documents mentioning an entity in the Federal Register. Returns rules, proposed rules and notices with title, type, agency, date, abstract and link. Source: Federal Register, public-domain.
  legalregulatoryenforcementfederal-registercompliancedue-diligencerulemakingagencypublic-recordsgovernment
• legal-profile
  Composite legal due-diligence profile of a business entity: litigation, patents and federal regulatory records in one call, plus a deterministic legal-risk signal (score 0-100, band, per-dimension flags and reasons).
  legaldue-diligenceprofilelegal-risklitigationpatentsregulatorycompliancekybpublic-records
• legislative-bill
  Look up one US federal bill by id: title, sponsor, cosponsors, committees, policy area, full action history and computed lifecycle stages (introduced to enacted). Source: Congress.gov + GovInfo, public-domain.
  legislativecongressbilllegislationsponsorvotelifecyclegovtrackcongress-govpublic-records
• legislative-search
  Search US federal bills by keyword (optionally within one Congress) and get a ranked list of matching bills with id, title and latest action. Source: Congress.gov, public-domain.
  legislativecongressbillsearchlegislationpolicykeywordcongress-govpublic-recordsgovernment
• legislative-rulemaking
  Find US proposed rules and rulemaking dockets by docket id, keyword or agency: documents, comment period, public-comment count and Federal Register links. Source: Regulations.gov + Federal Register, public-domain.
  regulatoryrulemakingregulationsproposed-ruledocketpublic-commentfederal-registercomplianceagencypublic-records
• legislative-timeline
  Stateless event diff for a US federal bill: which lifecycle stages it reached over a date window (introduced, committee, passed, enacted), each with date and source action. Source: Congress.gov, public-domain.
  legislativecongressbilltimelinelifecycleevent-difflegislationtrackingcongress-govpublic-records
• nutrition-search
  Search foods by name in USDA FoodData Central (public domain). Returns ranked matches with fdc_id, description, brand, GTIN and key macros per 100g.
  nutritionfoodusdasearchcaloriesmacrosdiet
• nutrition-food
  Full normalized nutrition profile for a USDA FoodData Central food by fdc_id: calories, macros and micronutrients per 100g and per serving.
  nutritionfoodusdamacrosmicronutrientscaloriesprofile
• nutrition-barcode
  Look up a packaged product by GTIN/barcode via Open Food Facts (global). Returns the normalized nutrition profile plus allergens, diet flags, Nutri-Score and NOVA.
  nutritionfoodbarcodegtinopenfoodfactsallergensvegan
• hazard-risk
  US property/location natural-hazard risk profile: FEMA National Risk Index composite (18 hazards, expected annual loss, social vulnerability) plus the FEMA flood zone, as one cited JSON verdict for a US address, coordinates, or FIPS.
  hazardriskpropertyreal-estateinsurancefloodfemanridue-diligenceus
• hazard-flood
  FEMA flood-zone lookup for a US point: Special Flood Hazard Area flag, FEMA flood zone (such as AE, VE, X), zone subtype, and base flood elevation, for a US address or coordinates.
  floodflood-zonesfhafemanfhlpropertyinsuranceus
• hazard-seismic
  USGS ASCE 7 seismic design values for a US point: Ss, S1, SDS, SD1, seismic design category, and PGA, for a US address or coordinates. Optional reference document, risk category, and site class.
  seismicearthquakeasce7usgsbuilding-codepropertyus
• govcon-awards
  Search awarded US federal contracts and grants from USASpending.gov, filtered by award type, recipient, agency, NAICS, keyword and fiscal year, returning a normalized award list plus a summary.
  govcongovernmentfederalcontractsgrantsprocurementusaspendingawardsnaics
• govcon-recipient
  Profile a federal contractor's spending footprint by name or UEI in one call: total federal dollars, top agencies, top NAICS, a fiscal-year trend and recent awards, fused from several USASpending.gov queries.
  govcongovernmentfederalcontractorrecipientvendorprocurementusaspendingspendingueidue-diligencesales-intelligencepublic-data
• govcon-agency
  Profile a US federal agency's procurement in one call: reported obligations and outlays plus top vendors, top NAICS and top product-service codes. Give an agency name or toptier code.
  govcongovernmentfederalagencyprocurementobligationsoutlaysvendorsnaicspscusaspendingpublic-datacompetitive-intelligence
• govcon-award
  Get the full detail of one US federal award by its generated_internal_id (returned from /govcon/awards): award id, type, description, total obligation, dates, awarding agency hierarchy and recipient with parent. The drill-down step after a /govcon/awards search.
  govcongovernmentfederalawardcontractgrantdetaildrill-downusaspendingprocurementpublic-data
• freight-carrier
  Fit-to-haul verdict for a US motor carrier from FMCSA registration data. Give one of dot, mc or name and get a verdict (fit, caution, unfit or not_found), a 0-100 fit score, per-dimension flags, reasons and weighted signals across authority status, operation, hazmat, safety rating, history, registration freshness, address and fleet. Deterministic, no LLM. Carrier vetting indicators, not legal or compliance advice.
  freightlogisticscarriertruckingfmcsadotmc-numbervettingdue-diligencebrokersupply-chaincompliance
• freight-lookup
  Search US motor carriers by name in the FMCSA Company Census and get ranked candidates, each with its USDOT number, MC docket, legal name, state, decoded carrier status, authority status and operation. Cheap first step before freight/carrier.
  freightlogisticscarriertruckingfmcsadotmc-numbersearchlookupbrokersupply-chain
• safety-vehicle
  Vehicle safety and recall check for a car, by make/model/year or by VIN. Fuses NHTSA open recalls, a complaint summary (crash, fire, injuries, deaths) and the 5-star NCAP safety rating into one cited JSON with a deterministic risk score. Risk indicators, not advice.
  safetyvehiclecarrecallnhtsavincomplaintssafety-ratingdue-diligencerisk-score
• safety-product
  Product recall and safety check for a consumer good, food, drug or medical device by brand or product name. Fuses CPSC and openFDA recalls into one cited JSON with hazard, FDA class, remedy, status and a deterministic risk score. Risk indicators, not advice.
  safetyproductrecallcpscopenfdafooddrugdeviceconsumer-safetyrisk-score
• energy-petroleum
  US petroleum prices and stocks from the EIA: retail gasoline and diesel by PADD region (weekly), WTI and Brent crude spot (daily), and weekly crude/gasoline/distillate inventories. Returns latest value, change vs prior period, short history, and a region-vs-US spread.
  energypetroleumoilgasolinedieselcrudewtibrenteiapricesinventory
• energy-natural-gas
  US natural gas data from the EIA: Henry Hub spot price (daily) and weekly working gas in underground storage (Bcf, Lower 48 or region). Returns latest value, change vs the prior period (week-over-week for storage), and short history. Source: U.S. Energy Information Administration.
  energynatural-gashenry-hubstorageeiapricesinventory
• energy-electricity
  US electricity data from the EIA grid monitor and retail survey: generation mix by fuel type with percentage breakdown (latest hour), demand by region, and average retail price by state/sector (monthly).
  energyelectricitypowergridgenerationdemandretail-priceeiafuel-mix
• energy-renewables
  Renewable share of US electricity generation from the EIA grid monitor: solar, wind, hydro and geothermal as a percentage of the latest hourly generation total, by grid region. Source: U.S. Energy Information Administration.
  energyrenewablessolarwindhydrogeothermalclean-energygrideiaesg
• quant-options
  Black-Scholes European option calculator: fair price, all greeks (delta, gamma, vega, theta, rho), or implied volatility from a market price. Pure computation over your inputs.
  quantoptionsblack-scholesgreeksimplied-volatilityderivatives
• quant-risk
  Portfolio risk metrics over an array of periodic returns: value-at-risk, conditional VaR, Sharpe, Sortino, max drawdown, Calmar, volatility, and more. Pure computation over your inputs.
  quantriskvarcvarsharpesortinodrawdownportfolio
• quant-kelly
  Kelly-criterion optimal bet fraction and position sizing from a win probability and payoff, or from an edge and odds. Pure computation over your inputs.
  quantkellyposition-sizingbankrollbetting
• quant-montecarlo
  Monte-Carlo geometric-Brownian-motion simulation of terminal price and European option payoff, with percentiles and a standard error. Pure computation over your inputs.
  quantmonte-carlogbmsimulationoptionspricing
• quant-defi
  DeFi math helper: APR and APY conversion, funding annualization, impermanent loss, liquidation price, and leverage. Pure computation over your inputs.
  quantdefiapyimpermanent-lossliquidationfundingleverage
• phone-intel
  Phone-number intelligence in one call: validity and E.164 normalization, line type (mobile, fixed line, VOIP, toll free, premium rate), country and region, carrier hint, timezones, and a deterministic 0-100 fraud/KYC risk score with a band and reasons. Offline number-plan metadata from Google libphonenumber. Risk indicators only, not a definitive fraud verdict; no live status and no owner identity; the input number is not stored.
  phonephone-numbervalidationverifyline-typecarriere164timezonefraudkycrisktelecom
• trade-tariff
  Estimate the effective US import duty for one HTS code from one origin country. Returns the base rate (MFN or FTA), the additional trade-war layers (Section 301, Section 232, IEEPA) with their Chapter 99 provisions, the combined effective rate, and an optional landed-cost estimate.
  tradetariffcustomsdutyhtsimportsection-301section-232ieepalanded-costsupply-chaintrade-compliance
• trade-hts
  Classify goods against the US Harmonized Tariff Schedule. Give a keyword or an HTS code and get the matching HTS lines with their duty-rate columns, units and footnotes. The cheap supporting lookup that feeds trade/tariff.
  tradehtsclassificationcustomstariffharmonizedimportduty-ratecommodity-code
• trade-flow
  US monthly import or export trade flow for a commodity from the Census Bureau. Give an HS code, a direction and an optional partner country and get monthly values, a trend and a supplier-concentration index. Degrades cleanly when the Census key is not configured.
  tradetrade-flowimportsexportscensushs-codesupply-chainconcentrationhhisourcingmacro
• provider-screen
  Screen a US healthcare provider against the OIG LEIE federal exclusion list. Exact NPI match returns an authoritative exclusion; a name match returns potential matches for review. Accepts an npi, a name, or an organization.
  healthcarecomplianceexclusionoigleiescreeningnpiprovidermedicaremedicaid
• provider-verify
  Full compliance verdict for a US healthcare provider: fuses live NPPES registration status, taxonomy and license, Medicare PECOS enrollment, and OIG LEIE exclusion into a deterministic verdict with risk flags. Accepts an npi, a name, or an organization.
  healthcarecomplianceproviderverificationnpinppespecosleieexclusioncredentialingmedicare
• fraud-ip-reputation
  Reputation of a public IP address for anti-abuse and KYC. Returns ASN, AS-org, country, datacenter/hosting classification, Tor-exit and Spamhaus DROP flags, plus a deterministic risk score with reasons.
  fraudanti-abuseipreputationrisktordatacenterasnkyc
• fraud-fusion-score
  Fusion anti-abuse risk score for an email and/or IP in one call. Combines domain-level email intelligence (MX, SPF, DMARC, disposable, free, role) with IP reputation into a deterministic 0-100 score with per-dimension reasons. Works with either input alone.
  fraudanti-abuseemailipriskkycfusiondisposablereputation
• notarize
  Notarize a public URL: we fetch it ourselves and return a signed snapshot (final URL, HTTP status, content-type, sha256 of the body, server timestamp, upstream host) with TWO cryptographic attestations — a plain EIP-712 signature and an EAS off-chain (Version2) attestation. Proves what this endpoint observed at fetch time (integrity + timestamp + non-repudiation). mode=hash (default) returns metadata + hash only; mode=full also returns the body.
  attestationnotarizeprovenanceeip712eassignaturesha256timestampverifiableintegrityweb-prooforacle
• attest-verify
  Verify an attestation produced by /notarize (either the EIP-712 or the EAS off-chain form) — pure compute, no network and no keys. Recovers the signer and reports whether it matches this service's attestor, whether the EAS UID recomputes, and (if you supply the original body as payload_base64) whether its sha256 matches the attested hash.
  attestationverifyeip712eassignaturerecoverprovenanceintegritypure-compute
• agri-production
  US crop production, yield, acreage and grain stocks from USDA NASS QuickStats by commodity, with an optional state and year. Returns a normalized cited series plus the year-over-year change.
  agriculturecommodityproductionyieldacreagestocksusdanassquickstatscornsoybeanswheatcotton
• agri-signal
  USDA NASS production and grain-stocks signal for a commodity: the QuickStats production and stocks series computed into context - production and stocks year-over-year change and history percentiles. When a USDA Market News key is configured it also folds in the spot/auction price and its change; without one it returns the NASS side and notes the gap.
  agriculturecommoditysignalproductionstocksusdanassanalytics
• realestate-market
  A composite US real-estate market profile for one geography. Fuses the FHFA House Price Index momentum, Census ACS demographics, housing, income, tenure and vacancy, national housing context, and Fair Market Rents into one cited JSON with computed derivatives such as gross rental yield and affordability. Aggregate market tier, not a per address valuation.
  real-estatehousingpropertymarkethome-pricesrentaffordabilityfhfacensusacshudusinvestment
• realestate-prices
  The FHFA House Price Index for a geography: the current index level plus year over year, quarter over quarter and five year growth, with momentum flags and a short history. State and metro CBSA levels are covered directly; county and ZIP resolve to the state level index. Public domain, US only.
  real-estatehome-priceshouse-price-indexfhfamomentumappreciationhousingus
• realestate-rents
  Rental market indicators for a geography: HUD Fair Market Rents by bedroom count when a HUD token is configured, plus the Census ACS median gross rent as context. Falls back to the ACS rent when HUD is not configured. Aggregate market tier, US only.
  real-estaterentfair-market-renthudacshousingrentalus
• realestate-compare
  Compare several US geographies on one real-estate metric: price momentum, gross rental yield, price to income, median home value, median gross rent or median household income. Returns a ranking plus rank, highest and lowest, spread and mean signals.
  real-estatecomparerankinghousingyieldaffordabilitymomentummetrous
• breach-password
  Check whether a password has appeared in known data breaches, using k-anonymity: the password is hashed locally and only a 5-character hash prefix is sent upstream, so the plaintext is never transmitted, logged or stored. Accepts a password, a SHA-1 hash or an NTLM hash. Returns compromised, breach_count and the hash prefix. Credential-exposure indicators, not a guarantee.
  breachpasswordcredentialpwnedk-anonymityaccount-takeoversecurityprivacyhaveibeenpwned
• breach-domain
  List the known public data breaches that affected a domain, from the Have I Been Pwned breach catalogue. Returns normalized breach metadata (name, date, account count, data classes, stealer-log and verified flags) plus a summary. This is which known breaches touched the domain, not whether a specific account is compromised. Breach indicators, not a guarantee.
  breachdomaindata-breachexposuredue-diligencesecuritystealer-loghaveibeenpwnedrisk
• breach-assess
  Composite account-takeover risk score (0-100) fusing a privacy-preserving password exposure check with a domain's known breach history. The password is hashed locally (k-anonymity, never transmitted). Returns ato_risk_score, a category, per-signal reasons and the raw signals so the agent can re-rank. Risk indicators, not a guarantee.
  breachaccount-takeoveratorisk-scorecredentialfusionsecurityk-anonymityhaveibeenpwned
• breach-account
  Look up the known breaches an email address appears in, returning breach METADATA only (name, date, data classes) and never passwords or leaked personal data. Uses the keyed Have I Been Pwned account API; when no API key is configured the route refuses with 503 and charges nothing, and the keyless password and domain routes still work. Breach indicators, not a guarantee.
  breachaccountemailexposurecredentialsecurityhaveibeenpwnedriskdue-diligence
• cve-lookup
  Vulnerability intelligence for a single CVE id. Fuses NVD (CVSS base score and vector, CWE, patch links), CISA KEV known-exploited status, EPSS exploitation probability and OSV.dev affected and fixed versions into one cited JSON with a deterministic patch-priority score. Risk indicators, not advice.
  cvevulnerabilitysecuritycvssepsscisa-kevnvdosvpatchadvisoryrisk-scorevuln-intelligence
• cve-scan
  Vulnerability scan for a software package by ecosystem, name and version, or by package-URL (purl). Queries OSV.dev for known advisories, collects their CVE ids and enriches them with NVD CVSS, CISA KEV and EPSS, then returns a prioritized list of advisories with exact fixed versions. Risk indicators, not advice.
  cvevulnerabilitysbompackagedependencypurlosvnpmpypimavenpatchsupply-chainrisk-score
• domain-trust
  Phishing/trust verdict for a website domain before an agent transacts with an unfamiliar merchant. Fuses registration age (RDAP), DNS/mail posture (SPF, DMARC, DNSSEC), TLS validity, Certificate Transparency history and a typosquat/homoglyph analysis into a composite trust score 0-100, a category (trusted / caution / untrusted / unknown), per-dimension flags and reasons. Trust indicators, not a guarantee.
  domaintrustphishingtyposquatanti-scamfraudriskdnscertificate-transparencydue-diligencereputation
• domain-typosquat
  Pure-compute typosquat and homoglyph check on a hostname: edit-distance to a curated brand list, look-alike character normalization, brand-in-subdomain lures, punycode/IDN, abused free-hosting suffixes and throwaway TLDs. Returns is_typosquat plus the nearest brand, edit distance and reasons. No network — instant, cheap.
  domaintyposquathomoglyphphishinganti-scamlexicalbrand-protectionidnpunycode
• drug-profile
  Clinical safety profile for a drug by brand, generic or active-ingredient name or NDC. Fuses FDA identity and approval status, key label sections, an adverse-event summary and a deterministic severity indicator into one cited JSON. Informational, not medical advice.
  drugmedicationpharmaopenfdaadverse-eventslabelseverityclinicaldue-diligencesafety
• drug-adverse-events
  Adverse-event summary for a drug from the FDA FAERS database by name. Returns the top reported reactions, the serious and death-flagged fractions and a demographic breakdown as aggregate counts. Informational, not medical advice.
  drugmedicationadverse-eventsfaerspharmacovigilanceopenfdasafety
• drug-label
  Key FDA structured-product-label sections for a drug by name: boxed warning, indications, dosing, contraindications, warnings, drug interactions and pregnancy. Informational, not medical advice.
  drugmedicationlabelsplboxed-warningcontraindicationsopenfdasafety
• drug-interactions
  Drug-interactions label section for a drug by name, with an optional check of whether the label mentions a second drug. A label-text heuristic, informational, not medical advice.
  drugmedicationinteractionslabelopenfdasafety
• device-adverse-events
  Adverse-event summary for a medical-device brand from the FDA MAUDE database. Returns counts of malfunctions, injuries and deaths by event type. Informational, not medical advice.
  devicemedical-devicemaudeadverse-eventsopenfdasafety
• drug-shortages
  Current FDA drug-shortage records for a generic drug name: status, therapeutic category, dosage form, company and dates. Informational, not medical advice.
  drugmedicationshortagesupplyopenfdasafety
• macro-indicator
  One macroeconomic or development indicator for one or more countries as a cited time-series. Fuses free authoritative sources (World Bank, IMF) and tags every value with its source, source code, year and country ISO3. Accepts a canonical indicator key or a raw World Bank code.
  macroeconomicsgdpcpiinflationunemploymentcountryworld-bankimfindicatorsdevelopment
• macro-country
  A curated headline basket of key macroeconomic and development indicators for one country: GDP, GDP per capita, growth, inflation, unemployment, population, government debt, current account, life expectancy and CO2 per capita. Latest value plus short history, each value cited to its source.
  macroeconomicscountry-profilegdpinflationworld-bankimfindicatorsdevelopmentoverview
• macro-compare
  One indicator compared across several countries: the latest value for each plus computed signals — rank, highest and lowest, spread and mean. Each value is cited to its source.
  macroeconomicscomparerankinggdpinflationcountryworld-bankimfindicators
• macro-forecast
  IMF World Economic Outlook forecasts for a country: real GDP growth, inflation, nominal GDP, GDP per capita, government debt, current account and unemployment, including projected future years. Values are cited to the IMF WEO.
  macroeconomicsforecastimfweogdp-growthinflationprojectioncountryoutlook
• pii-scan
  Detect structured PII in a text blob: emails, phones, credit cards, bank and tax ids, IP and MAC addresses, crypto addresses, dates of birth, geo coordinates and secrets. Returns findings with a confidence score plus a compliance summary. No transformed text. Structured PII indicators, not legal advice.
  piiprivacygdprhipaapcidetectioncomplianceredactionagentsafety
• pii-redact
  Detect and transform structured PII in a text blob. Returns the sanitized text plus a findings report. Modes: redact, mask, hash, or reversible tokenize (the token map is returned in the response — nothing is stored). Optional per-type mode overrides and an allow-list. Structured PII indicators, not legal advice.
  piiprivacygdprhipaapciredactionmaskingtokenizationcomplianceagent
• scholar-paper
  Resolve one research paper and fuse its metadata across OpenAlex, Crossref, Unpaywall and Semantic Scholar into a single cited JSON. Give a doi, arxiv, pmid, pmcid, openalex_id or title and get canonical metadata, authors with ORCID and affiliations, venue, citation counts, an open-access PDF link and a full id crosswalk.
  scholarresearchpaperdoicitationopenalexcrossrefunpaywallsemantic-scholarmetadataopen-accessliterature
• scholar-search
  Search the scholarly literature by keyword or topic and get a ranked list of works with core metadata. Optional filters for year range, open-access only, concept and institution. Powered by OpenAlex. A cheap first step before /scholar/paper.
  scholarresearchsearchliteratureopenalexpaperslit-reviewdiscoverymetadata
• scholar-citations
  Citation graph of a paper: the works it references (outgoing) and the works that cite it (incoming), each as normalized records, plus the Semantic Scholar influential-citation count. Give a doi, arxiv, pmid, openalex_id or title. Ideal for literature review and prior-art mapping.
  scholarresearchcitationsreferencescitation-graphprior-artlit-reviewopenalexsemantic-scholarbibliometrics
• scholar-author
  Disambiguate a researcher and return their profile: works count, citation count, h-index, institutions with ROR, top concepts and top works. Give an orcid for a resolved profile, or a name for ranked candidates. Distinct people are never merged.
  scholarresearchauthorresearcherorciddisambiguationh-indexopenalexaffiliationbibliometrics
• scholar-oa
  Locate a free open-access PDF for a DOI. Returns whether an open-access copy exists and the best PDF link with its license, version and host type, from Unpaywall and OpenAlex. A cheap, focused open-access locator.
  scholarresearchopen-accessoapdfdoiunpaywallopenalexfulltext-link
• txsafety-signature
  Pre-sign safety verdict for an off-chain EIP-712 signature (EIP-2612, Permit2, EIP-3009). Decodes what it authorizes (spender, token, amount, deadline), checks domain-spoof, approval-hygiene and scam-blocklist, returns allow, warn or block plus a 0-100 risk. Risk indicators, not advice.
  securitysignatureeip712permit2eip3009approvalphishingwalletonchain
• txsafety-raw
  Pre-sign safety verdict for a raw EVM transaction. Decodes the calldata against a known-signature registry, shows known-pattern effects (approval delta, transfer target), dry-runs eth_call for revert, checks scam-blocklist and approval-hygiene, and returns allow, warn or block plus a 0-100 risk. Risk indicators, not advice.
  securitytransactioncalldataapprovalabiphishingwalletonchain
• gdelt-news
  Recent global news articles from the GDELT Project by topic, country, entity or theme, normalized to title, link-back url, domain, source-country, language and ISO timestamp — plus coverage breakdowns (top source-countries, top domains, languages, count) derived from the same result. One call instead of querying and parsing GDELT yourself.
  newsgeopoliticsworldeventsgdeltglobalmediaintelligenceosintcoveragemultilingualresearch
• gdelt-tone
  Native multilingual tone/sentiment for a topic from the GDELT Project: a tone histogram (emotional bins with example articles), a coverage-weighted average tone and label, the modal bin, and an optional tone trend over time. GDELT's own cross-language tone (a differentiator over English-only lexicon scoring).
  sentimenttonenewsgeopoliticsgdeltmultilingualmoodintelligenceosintresearchglobal
• gdelt-timeline
  Coverage timeline for a topic from the GDELT Project: pick metric volume (share of all monitored coverage — is a topic heating up or cooling down) or tone (average-tone trend). Returns normalized time-series points plus the latest value and a rising/falling/flat trend. One upstream call.
  timelinetrendnewsvolumetonegdeltgeopoliticsintelligenceosintmonitoringresearchglobal
• gdelt-pulse
  Fusion intelligence for a world topic in ONE call: recent articles + coverage breakdowns (top source-countries, domains, languages) + a tone trend with the current average tone and direction — all normalized and cited. Saves 4-5 separate GDELT calls and their parsing. Research latency, not real-time trading.
  intelligencefusionnewsgeopoliticstonecoveragegdeltosintglobalmultilingualresearchbrief
• btc-fees
  Recommended Bitcoin transaction fee-rates in sat per vByte across five confirmation horizons (fastest, half hour, hour, economy, minimum) plus a live mempool congestion snapshot with an estimated block backlog. Informational, not advice.
  bitcoinbtcfeesfee-ratesat-vbmempoolcongestionon-chainblockchain
• btc-mempool
  Live Bitcoin mempool snapshot: unconfirmed transaction count, total virtual size and total fees, a fee-rate histogram broken into buckets, and an estimated block backlog. Informational, not advice.
  bitcoinbtcmempoolfee-histogrambacklogcongestionunconfirmedon-chainblockchain
• btc-address
  Balance and unspent outputs for a Bitcoin address. Returns confirmed and mempool balance, funded and spent totals, transaction count and a capped UTXO set for a legacy, p2sh or bech32 address. Informational, not advice.
  bitcoinbtcaddressbalanceutxounspentwalleton-chainblockchain
• btc-tx
  Decoded Bitcoin transaction by txid: inputs and outputs, fee, size, weight and virtual size, replace-by-fee flag, and confirmation status with a confirmation count. Informational, not advice.
  bitcoinbtctransactiontxidrbffeeconfirmationson-chainblockchain
• btc-block
  Bitcoin block metadata by height or hash (or the chain tip when neither is given), fused with the current difficulty-adjustment context, a computed halving countdown and a network hashrate snapshot. Informational, not advice.
  bitcoinbtcblockhalvingdifficultyhashrateretargeton-chainblockchain
• tax-income
  US federal income tax estimate for a tax year: taxable income, tax, marginal and effective rate, per-bracket breakdown, with an optional state estimate. Pure computation over your inputs, not tax advice.
  taxincome-taxfederalirsbracketsus
• tax-fica
  US payroll tax estimate: Social Security and Medicare on wages, or self-employment tax, including the additional Medicare surtax. Pure computation over your inputs, not tax advice.
  taxficapayrollsocial-securitymedicareself-employment
• tax-capgains
  US capital gains tax estimate: long-term 0/15/20 percent rates or short-term ordinary rates, plus the net investment income tax. Pure computation over your inputs, not tax advice.
  taxcapital-gainsniitinvestmentslong-termshort-term
• tax-paycheck
  US take-home paycheck estimate: federal income tax plus payroll tax and an optional state estimate, giving net pay per period and disposable income. Pure computation over your inputs, not tax advice.
  taxpaychecktake-homenet-paydisposable-incomepayroll
• tax-brackets
  Reference tables for a US tax year and filing status: income brackets, standard deduction, FICA constants, and capital-gains breakpoints. Pure lookup, not tax advice.
  taxbracketsreferencestandard-deductionirsus
• aeo-audit
  AI-search visibility (AEO) audit of a website for answer engines and agents. Fetches the target's own public surface and computes a composite visibility score 0-100 with a rating (poor, fair, good, excellent) across six axes: answerability, structured data, AI-crawler access, crawlability, llms.txt readiness and MCP well-known readiness, plus a prioritized list of fixes. Deterministic, no LLM. Visibility indicators, not a guarantee.
  aeoai-searchanswer-engineseovisibilityllms-txtrobotsstructured-dataschema-orgcrawlabilityauditgenerative-engine-optimizationgeo
• aeo-llms
  Focused check of a site's /llms.txt and /llms-full.txt: presence, size and llmstxt.org structural validity (an H1 title, a blockquote summary, sections of markdown links). Returns a readiness score plus fixes. Cheap sub-check of the full AEO audit.
  aeollms-txtai-searchanswer-enginellmstxtreadinessagent-readable
• aeo-crawlers
  robots.txt AI-crawler access matrix: for the 2026 cohort of AI and answer-engine crawlers (GPTBot, ChatGPT-User, OAI-SearchBot, ClaudeBot, Claude-User, PerplexityBot, Google-Extended and more) reports allowed, blocked or unlisted per bot, whether the default rule blocks everything, declared sitemaps and a score. One network operation.
  aeorobots-txtai-crawlergptbotclaudebotperplexitybotai-searchaccess-controlcrawl
• seo-audit
  Deterministic on-page technical-SEO audit of a single web page. Fetches the page (redirects + response headers) and runs 24 mechanical rules across six categories (indexability, title/meta, headings, structured data, images, i18n/mobile). Returns a 0-100 score, letter grade, per-rule pass/warn/fail checklist with fixes, and an indexability-critical flag. No LLM, no keys.
  seotechnical-seoon-page-seoauditindexabilitymeta-tagsstructured-datasitemapsite-audit
• validator-vet
  Delegation-risk verdict for a Solana validator from public on-chain data. Give one of vote (vote-account) or identity (node) pubkey and get a verdict of safe, caution, avoid or not_found, a 0-100 risk score, per-dimension flags, reasons and weighted signals across delinquency, commission, commission-rug history, skip-rate percentile, vote-credit performance, agent version lag and superminority concentration. Deterministic, no LLM. Risk indicators, not financial or staking advice.
  solanavalidatorstakingdelegationdue-diligenceriskvettingcommissionsuperminorityskip-rateproof-of-stake
• validator-lookup
  Resolve a Solana validator identity pubkey to its vote-account (or the reverse) and optionally get the top-N lowest-risk safe validators by score. Give vote or identity to resolve, or top_n for safe candidates. Cheap first step before validator/vet.
  solanavalidatorstakingdelegationlookupresolvevote-accountidentitytop-validatorsproof-of-stake
• depin-hotspot
  Profile of a DePIN hotspot or gateway from public data. Give network (helium) and an entity or asset key and get owner wallet, subnetworks (IOT, MOBILE), obfuscated location (city, state, country and H3 cell), elevation, gain, onboarding fee and computed flags for asserted location, multi-network and deployment completeness. Each value is cited to its source.
  depinheliumhotspotgatewaywirelessiotmobilenetwork-intelligencecoverage
• depin-wallet
  Portfolio of a DePIN operator or investor wallet from public data. Give network (helium) and a Solana wallet pubkey and get the hotspot count, a breakdown by subnetwork, the geographic spread, token balances (HNT, IOT, MOBILE, DC) and computed signals for deployment diversification and concentration. Each value is cited.
  depinheliumwalletportfoliooperatorinvestoriotmobiletokensnetwork-intelligence
• depin-network
  Network health and token-economics verdict for a DePIN network from public data. Give network (helium) and get coverage size (IOT and MOBILE node counts), token supply for HNT, IOT, MOBILE and DC read on-chain, the emission and halving context, and a coverage-scale indicator. Each value is cited to its source.
  depinheliumnetworktokenomicssupplycoveragehealthhntnetwork-intelligence
• depin-coverage
  Coverage density and deployment opportunity for a geography on a DePIN network. Give network (helium) and a geo string (city, state, country or an H3 cell). This is a keyed enrichment: without the Relay key configured it returns available false with a note; the keyless network, hotspot and wallet routes do not need it.
  depinheliumcoveragedensitygeodeploymentopportunitynetwork-intelligence
• depin-rewards
  Reward economics and earnings trend for a DePIN entity or subnetwork. Give network (helium) with an entity key or a subnetwork (iot, mobile). This is a keyed enrichment: without the Relay key configured it returns available false with a note; the keyless network, hotspot and wallet routes do not need it.
  depinheliumrewardsearningseconomicstrendiotmobilenetwork-intelligence
• farcaster-profile
  One-call Farcaster profile fusion. Give one of fid or username and get back the full profile (display name, bio, picture, url, location, socials), the primary Ethereum address, every verified on-chain wallet, the custody address, following and follower and cast counts, and the account age — the fused object that replaces four or five raw hub reads.
  farcasterprofilesocialfidwalletidentityweb3basecryptosocial-graphreputationonchain
• farcaster-verifications
  Resolve a Farcaster identity to its verified on-chain wallets. Give one of fid or username and get every cryptographically verified address (Ethereum and Solana) linked to that FID, plus the in-profile primary Ethereum address and provenance. The forward identity to wallet direction for reputation and provenance work.
  farcasterverificationswalletfididentityethereumsolanaweb3cryptoprovenanceaddress
• farcaster-resolve
  Bidirectional Farcaster identity and wallet resolver. Give an address to get the FID it belongs to (custody address resolves keyless; a verified address needs the optional enrichment), or give a fid or username to get the canonical identity (fid, username, custody address and verified wallets). Crypto-native reconciliation of social identity and wallet.
  farcasterresolveidentitywalletfidaddressreverseweb3cryptoreconciliationcustodybase
• farcaster-reputation
  Deterministic Farcaster social-reputation score from zero to one hundred for a fid, username or address. Combines account age, verified wallets, a primary address, username presence, follower floor and cast activity into a score, a band and per-dimension reasons. Anti-sybil and provenance signal for crypto agents. Reputation indicators, not a guarantee.
  farcasterreputationscoreanti-sybilidentityfidwalletweb3cryptotrustprovenancebase
• farcaster-graph
  Farcaster social-graph slice for a fid or username: the following list with a count, the follower floor with a count, and a sample of mutual connections. Counts for large accounts are a floor with a capped flag. Social-graph context for reputation and network-analysis agents.
  farcastergraphsocial-graphfollowingfollowersfidnetworkweb3cryptomutualsreputationbase
• sports-scores
  Live and recent game scores for a major sports league, normalized to one cited JSON. Give a league such as mlb, nhl, nfl, nba or epl and get each game with both teams, the score, the game state, the period or inning and the start time. Sourced from official league APIs and ESPN, each record tagged with its source.
  sportsscoreslivemlbnhlnflnbasoccerresultsfactsscoreboard
• sports-schedule
  Upcoming fixtures and the game schedule for a major sports league, normalized to one cited JSON. Give a league such as mlb, nhl, nfl, nba or epl and an optional date, and get each scheduled game with both teams, start time and venue. A cheap way for an agent to plan around the sports calendar.
  sportsschedulefixturescalendarmlbnhlnflnbasoccerupcoming
• sports-standings
  League table and standings for a major sports league, normalized to one cited JSON. Give a league such as mlb, nhl, nfl, nba or epl and get each team with wins, losses, win percentage or points, games behind, streak and its division or conference group. Sourced from official league APIs and ESPN.
  sportsstandingstableleague-tablemlbnhlnflnbasoccerwinslossesstreak
• sports-game
  Deep single-game state for one game by its id, normalized to one cited JSON. Give a league and a game_id and get the box-score numbers, the status and period or inning, team totals, statistical leaders and any reported injuries. The richest per-game view, fused from the league API or ESPN.
  sportsgamebox-scoreplay-by-playleadersinjuriesmlbnhlnflnbasoccer
• sports-team
  Team profile for a major sports league, normalized to one cited JSON. Give a league and a team name or abbreviation and get the team's record, home venue, country, year founded and recent form where available. Fused from official league APIs, ESPN and TheSportsDB.
  sportsteamprofilerosterrecordvenuemlbnhlnflnbasoccer
• politics-fec-contributions
  Federal campaign contributions from FEC Schedule A. Give a contributor name, committee id or candidate id and get normalized itemized receipts, each cited to its FEC filing, with contributor employer and occupation, amount, date and the recipient committee. Optional employer, two year period and minimum amount filters. Informational public disclosure data, not for donor solicitation.
  feccampaign-financecontributionsschedule-adonormoney-in-politicscompliancedue-diligencepepopposition-research
• politics-fec-committee
  FEC committee profile for a PAC, Super PAC or candidate committee. Give a committee id or a name query and get the committee type, party and designation plus per-cycle totals of receipts, disbursements and cash on hand, and a summary of independent expenditures it made supporting or opposing candidates. Public disclosure data for research and compliance.
  feccommitteepacsuper-pacindependent-expenditurescampaign-financemoney-in-politicstotalsdue-diligence
• politics-lobbying-filings
  Federal lobbying filings from the Senate LDA disclosure system covering both chambers. Give a client name, registrant firm name, lobbyist name or issue code and get normalized filings with the registrant, client, reported income or expenses, issue areas, government entities lobbied and the lobbyists, each cited to its filing document. Optional filing year and period filters.
  lobbyingldasenatedisclosureregistrantclientmoney-in-politicspolicycompliancedue-diligence
• politics-lobbying-spend
  Lobbying-spend profile for a company or organization by name. Fuses the entity's Senate LDA filings into total reported spend by year with a trend, the top issue areas and the registrant firms it hired, plus recent cited filings. Optionally adds a bounded summary of the LD-203 political contributions reported by its top registrant firms.
  lobbyingldaspendcompanytrendissuesregistrantsmoney-in-politicscomplianceesgdue-diligence
• politics-profile
  Cross-domain money-in-politics footprint of one entity by name. Fuses the entity's FEC campaign contributions as a donor with its Senate LDA lobbying spend as a client into one cited profile with aggregates across both domains. Partial on failure per domain. Informational public disclosure data for due-diligence, not for donor solicitation.
  money-in-politicsprofilefecldacross-domainfootprintdue-diligencecompliancepepesgopposition-research
• bank-verify
  Bank account / IBAN verification in one call: ISO 13616 checksum + per-country structure validation, BIC / bank name / branch resolution, country details, SEPA-zone flag, and a deterministic 0-100 fraud/KYC risk score with a band, reasons and weighted signals. Offline open-registry data (schwifty, MIT). Structural + resolution + risk indicators only; NOT proof the account exists or who owns it, and no name matching. Input not stored.
  bankibanbank-accountverifyvalidationbicswiftsepafraudkycamlpaymentsrisk
• bank-validate
  Cheap structural IBAN validation: ISO 13616 checksum + per-country structure/length. Returns valid plus, on rejection, a granular error_type (invalid_checksum, invalid_length, invalid_structure, invalid_country), the country and the format spec. Offline (schwifty, MIT); no network or keys. A cheap-first entry before the fuller /bank/verify fusion route.
  bankibanvalidatechecksumstructureformatsepapayments
• bank-bic
  Reverse BIC / SWIFT code lookup: given a BIC, return the resolved bank name(s), the country and the domestic bank codes. Offline open-registry data (schwifty, MIT); no network or keys. A malformed BIC returns valid false with an error_type, never a 500.
  bankbicswiftlookupbank-namereversepaymentskyc
• treasury-auctions
  US Treasury auction results plus the upcoming calendar from TreasuryDirect. Returns a normalized list of recent auctions for a security type with computed signals: bid-to-cover trend, indirect-bidder share and average cover. Each auction is cited with its CUSIP, auction date and source.
  treasuryauctionsdebt-issuancebillsnotesbondstipsbid-to-covertreasurydirectfixed-incomeus-government
• treasury-debt
  US federal debt from the Treasury Debt to the Penny series, split into debt held by the public and intragovernmental holdings, fused with interest expense on the debt. Returns the latest value, the history over a window and computed net issuance plus public and intragovernmental shares. Values are cited to Treasury Fiscal Data.
  treasurynational-debtdebt-to-the-pennypublic-debtinterest-expensefiscalus-governmentfiscaldata
• treasury-cash
  The US Treasury operating cash balance (the Treasury General Account) from the Daily Treasury Statement. Returns the latest TGA closing balance, the history over a window and the computed daily change flagged as a build or a drawdown. Cited to Treasury Fiscal Data.
  treasurytgaoperating-cashdaily-treasury-statementliquiditycash-balancefiscalus-governmentfiscaldata
• treasury-statement
  The US Monthly Treasury Statement: federal receipts, outlays and the deficit or surplus for the latest month and fiscal year to date, fused with interest expense. Computes the deficit change year over year and interest expense as a share of receipts. Cited to Treasury Fiscal Data.
  treasurymonthly-treasury-statementreceiptsoutlaysdeficitbudgetfiscalus-governmentfiscaldata
• treasury-rates
  US Treasury interest rates: the Daily Treasury Par Yield Curve fused with the average interest rates on the outstanding debt by security type. Computes the 2s10s spread and an inversion flag. The yield curve is a resilient partial grain that degrades to the average rates if its upstream is unreachable.
  treasuryyield-curveinterest-ratespar-yield2s10sinversionaverage-interest-ratefixed-incomeus-government
• prediction-search
  Cross-venue prediction-market search: one query returns a ranked list of NORMALIZED markets from Polymarket (real-money) and Manifold (play-money) under one schema — implied probability, outcomes, volume, liquidity, close date, status, money_type and a link-back. One call instead of hitting each venue's API and reconciling their shapes.
  prediction-marketspolymarketmanifoldforecastingoddsprobabilitysearchmarketssentimentresearch
• prediction-event
  Cross-venue event fusion: match the SAME event across prediction venues (deterministic fuzzy title match + resolve-date proximity) and return each venue's implied probability, a money-type-weighted consensus, and a forecast-divergence signal (venue disagreement, not a tradeable arbitrage).
  prediction-marketsconsensusforecastdivergencepolymarketmanifoldeventprobabilityfusionsignal
• prediction-market
  Detail of ONE prediction market or event by numeric id, 0x conditionId, market-slug or event-slug (auto-detected): normalized outcomes with implied probabilities, volume, liquidity, close date, status and a link-back.
  prediction-marketspolymarketmarket-detailoddsprobabilityconditionidslugeventoutcomeslookup
• prediction-trending
  Top trending prediction events by 24-hour traded volume: a normalized list with 24h and total volume, liquidity, market count, a top-market summary, close date, status and a link-back.
  prediction-marketspolymarkettrendinghotvolume24heventsoddsprobabilitydiscovery
• prediction-trades
  Recent trades for one prediction market (by conditionId, slug or numeric id): a PII-stripped pseudonymous feed plus a derived summary — trade count, buy/sell volume and counts, size-weighted average price, last price and range.
  prediction-marketspolymarkettradesorder-flowvwapbuy-sellactivitymarketonchainfeed
• prediction-prices
  Odds/price history for ONE outcome of a prediction market (by id, 0x conditionId or slug): a normalized implied-probability time series plus a momentum summary — change, percent change, min/max, current and trend.
  prediction-marketspolymarketprice-historyodds-historytimeseriesmomentumprobabilitytrendforecastingclob
• match-name
  Fuzzy-match two names or addresses and return a 0-100 similarity score with a match decision. Normalizes legal forms, business stop-words, person titles and address abbreviations BEFORE the fuzzy compare, then fuses token, prefix, phonetic and edit similarity. Returns the score, the per-component scores, the normalized forms and is_match. Similarity indicators, not authoritative identity resolution.
  record-linkagefuzzy-matchingname-matchingdedupentitycompanypersonaddressdata-qualitymdm
• match-key
  Compute a deterministic similarity key for a name or address: the cheap first step of client-side blocking and deduplication. Records that share a key are duplicate candidates to confirm. Returns the key, the normalized form and the tokens. Indicators, not authoritative identity resolution.
  record-linkagesimilarity-keyblockingdedupentitycompanypersonaddressdata-qualitymdm
• match-standardize
  Standardize a company name, person name or address to a canonical form. Canonicalises legal forms, drops business stop-words, strips person titles and suffixes and folds address abbreviations. Returns the canonical form, the tokens and the rules that were applied. Indicators, not authoritative identity resolution.
  record-linkagestandardizationnormalizationcleansingentitycompanypersonaddressdata-qualitymdm
• match-dedupe
  Deduplicate a list of names or addresses into clusters of likely duplicates. Blocks by similarity key then confirms pairwise inside each block, returning clusters with a canonical representative plus a summary of input, cluster and duplicate counts. Similarity indicators, not authoritative identity resolution.
  record-linkagededupdeduplicationclusteringentitycompanypersonaddressdata-qualitymdm
• env-facility
  US facility environmental due-diligence: one cited JSON verdict fusing EPA compliance status, enforcement history, penalties, toxic releases and reported greenhouse gases, with a 0 to 100 environmental-risk score, for a company name, EPA FRS registry id, address, or coordinates.
  environmentalcomplianceesgepaechoemissionstrigreenhouse-gasdue-diligenceriskus
• env-compliance
  US facility EPA compliance and enforcement detail: current significant-violation status by statute, quarters in noncompliance, formal and informal actions, penalties, and inspection dates, for a company name, FRS registry id, or location.
  environmentalcomplianceenforcementviolationsepaechopenaltiesdue-diligenceus
• env-emissions
  US facility emissions profile: EPA Toxics Release Inventory toxic releases with trend plus the Greenhouse Gas Reporting Program CO2e profile by year, for a company name, FRS registry id, or location.
  environmentalemissionstritoxic-releasegreenhouse-gasghgco2eepaesgus
• env-screen
  Screen US EPA-regulated facilities: fuzzy name or location search returning ranked candidate facilities with their EPA FRS registry id and compliance status — the cheap first step before a full env facility verdict.
  environmentalscreensearchepafacilityfrsus
• trials-study
  Resolve one clinical trial by its NCT id and get a normalized cited profile: identity, recruitment status, phase, study design, target enrollment, lead sponsor and collaborators, conditions, interventions, primary outcomes, trial sites and key dates, plus computed signals from ClinicalTrials.gov.
  clinical-trialsclinicaltrials-govtrialnctpharmabiotechdrug-developmentpipelineenrollmentsponsorhealthcare
• trials-search
  Search ClinicalTrials.gov by indication, company, molecule or free text and get a ranked list of normalized trial records with total count and on-page facet summary. Optional phase, status, study-type and country filters. A cheap first step before /trials/study or /trials/pipeline.
  clinical-trialsclinicaltrials-govsearchindicationsponsordrugmoleculepharmabiotechpipelinediscovery
• trials-pipeline
  Deterministic clinical pipeline aggregation for one molecule, indication or sponsor: trial counts by phase and by recruitment status, active, completed and recruiting totals, and a near-term readout list of trials with a primary completion date coming up soon. Computed from ClinicalTrials.gov, no model involved.
  clinical-trialsclinicaltrials-govpipelinephaseaggregationdrug-developmentpharmabiotechsponsorreadoutcatalyst
• trials-results
  Summarize the posted results of a clinical trial by NCT id: results-posted date, aggregate participant flow, primary outcome measure metadata and aggregate serious adverse-event counts from ClinicalTrials.gov. Reports has_results false when no results have been posted.
  clinical-trialsclinicaltrials-govresultsoutcomesadverse-eventssafetyefficacypharmabiotechreadout
• nonprofit-profile
  Composite due-diligence profile of a US 501(c) nonprofit by EIN or name: identity (name, EIN, decoded NTEE, subsection, foundation type, ruling date), current IRS status fusion (Pub 78 deductibility, auto-revocation, exempt status), latest Form 990 financials, multi-year trend, cited filings, and a deterministic health and risk indicator set.
  nonprofitcharity501c3due-diligenceirsform-990grantmakingeintax-exempt
• nonprofit-status
  Crisp authoritative IRS tax-exempt status for a US nonprofit by EIN: whether it is currently tax-exempt, listed in Publication 78 as able to receive deductible contributions with the eligibility code, whether its status was automatically revoked with the revocation and reinstatement dates, and its 501(c) subsection.
  nonprofitcharityirstax-exemptpub78deductibleauto-revocationcomplianceein
• nonprofit-financials
  Normalized multi-period Form 990 financials for a US nonprofit by EIN: revenue, expenses, contributions, program revenue, assets, liabilities, net assets and officer compensation per tax year, plus computed ratios (program support, overhead, officer-compensation share, net margin) and gap flags, each number cited to its filing.
  nonprofitcharityform-990financialsirsrevenueexpensesexecutive-compensationein
• nonprofit-search
  Resolve a US nonprofit name to ranked candidate organizations, each with EIN, name, city, state, decoded NTEE, subsection and a match score. The cheap first step for EIN-to-name disambiguation, optionally narrowed by state, NTEE category or 501(c) subsection.
  nonprofitcharitysearcheindisambiguationirs501c3lookup
• travel-entry
  International entry requirements for a passport and destination pair. Fuses the community visa requirement, a passport-validity rule, the US State Dept travel advisory level and summary, and current CDC travel-health notices into one cited JSON with derived documents and notes. Informational, not immigration advice.
  travelvisaentry-requirementspassportadvisoryhealth-noticeimmigrationborderagentic-travelcompliance
• travel-advisory
  US State Department travel advisory for a destination country. Returns the advisory level one to four, its label, the summary and the last-updated date, normalized to one cited JSON. Authoritative and live. Informational, not travel advice.
  traveladvisorystate-departmentsafetydestinationrisk-level
• travel-health
  US CDC travel-health notices for a destination country. Returns the current outbreak and health notices for that country plus any global-scope notices, each with its level, title and link. Authoritative and live. Not medical advice.
  travelhealthcdcoutbreakvaccinediseasedestination
• travel-visa
  Visa requirement for a passport and destination pair from a community visa-matrix. Returns the normalized requirement such as visa free, visa on arrival, e-visa, electronic travel authorization or visa required, with the visa-free day allowance where applicable. Indicative, not authoritative. Verify with the embassy.
  travelvisapassportvisa-requirementvisa-freee-visavisa-matrix
• osha-screen
  Search US employers in the public OSHA enforcement records by establishment name and get ranked candidates, each with its state, SIC and NAICS codes, last inspection date, inspection count, summed violation count and the most serious inspection trigger. Cheap first step before osha/company.
  oshaworkplace-safetylaborcomplianceinspectionviolationsdue-diligencevendor-screeningesgsupply-chaindolsearch
• osha-company
  Workplace-safety risk verdict for a US employer from public OSHA enforcement records. Give an establishment name and optional state and get a 0-100 safety risk score, a low, medium, high or critical rating, per-dimension flags, reasons and a cited list of the inspections behind the score. Deterministic, no LLM. Risk indicators, not legal or compliance advice.
  oshaworkplace-safetylaborcomplianceinspectionviolationspenaltywillfulrepeatrisk-scoredue-diligencevendor-screeningesgsupply-chainm-and-adol
• hospital-price-discover
  Find a US hospital's machine-readable price files from its website domain. Reads the hospital's root cms-hpt.txt pointer and returns the location name, source page and machine-readable-file URL for each location, with the detected file format.
  hospitalprice-transparencyhealthcaremrfcmsdiscoverycms-hptbilling
• hospital-price-lookup
  Negotiated, gross and cash prices a hospital publishes for a procedure code, plus fused CMS Care Compare quality. Streams the slice of the hospital's own machine-readable file for one billing code and cites the file's hospital name, date and version. Informational, not a quote.
  hospitalpricenegotiated-ratecash-pricegross-chargecmscare-comparequalityprocedurehealthcaremrffusion
• hospital-price-benchmark
  Medicare national reference price for a procedure code — a cheap anchor to compare hospital prices against. Returns the average Medicare submitted, allowed and payment amounts per place of service from CMS public data. Informational.
  hospitalpricebenchmarkmedicarereference-pricecmshcpcscpthealthcare
• adviser-verify
  Composite due-diligence verdict for a US financial professional or firm, fusing FINRA BrokerCheck and SEC IAPD by CRD number into one cited JSON: registration status and scope, exams, employment history, disciplinary disclosures, a deterministic risk score from 0 to 100 and a verdict. Accepts a crd, or a name, or a firm.
  financecompliancedue-diligencebrokerinvestment-adviserfinrabrokercheckseciapdcrddisclosureverification
• adviser-screen
  Resolve a financial professional or firm name to ranked CRD candidates for disambiguation before an authoritative verify call. Each candidate carries its crd, name, current firm, broker and adviser scope, and a disclosure flag. Accepts a name, or a firm.
  financecompliancebrokerinvestment-adviserfinrabrokercheckseciapdcrddisambiguationscreening
• insider-trades
  Normalized corporate-insider transactions from SEC Form 3, 4 and 5 filings. Give a ticker or issuer CIK and get each director, officer and 10-percent-owner transaction: transaction code, security, shares, price per share, value, acquired or disposed, direct or indirect holding, the insider role, and the disclosure lag, every record cited to its accession and form4.xml URL.
  insidersecform-4form-3form-5ownershipinsider-tradingdirectorsofficers10-percent-ownerdisclosuredue-diligencetickercik
• congress-trades
  Normalized US House congressional stock trades from STOCK Act Periodic Transaction Reports. Filter by ticker or member and an optional date window and get each disclosed trade: buy, sell or exchange, the amount range, ticker, asset description, transaction and disclosure dates, disclosure lag, and owner, each record cited to its filing PDF.
  congresscongressional-tradingstock-actptrhousepolitician-tradesdisclosurerepresentativesdue-diligenceticker
• insider-signal
  Composite deterministic insider and congressional signal for one ticker over a window. Fuses SEC Form-4 insider transactions and US House STOCK Act trades into a 0-100 signal score plus flags: net insider buying, cluster buy across distinct insiders, unusual volume, congressional activity, and average disclosure lag. Each flag references the underlying transactions.
  insider-signalcluster-buyalphadue-diligencesecform-4congressstock-actsignalscreeningticker
• insurance-model-law
  Per-state adoption of a NAIC insurance model law. Give a model number or a title keyword and get a normalized state-by-state table classifying each US jurisdiction as model adoption, previous version, related activity or no current activity, each with its statutory citation, plus a linkback to the NAIC source and required attribution.
  insuranceregulationcompliancenaicmodel-lawadoptionstate-lawinsurance-regulatorystatutecitationcited
• insurance-state-adoption
  Which NAIC insurance model laws a given state has adopted, inverted from the NAIC state-page corpus. Give a state (name or code) and an optional model or topic filter and get the models it has adopted with each classification, citation and linkback.
  insuranceregulationcompliancenaicstate-adoptionmodel-lawstate-lawinsurance-regulatorycitationcited
• insurance-bulletins
  Recent Department of Insurance bulletins, circular letters and notices for a state, normalized to title, url, year and type with a linkback. Curated subset of reachable states, filterable by keyword and year, partial-on-failure.
  insuranceregulationbulletincircular-letterdoiguidancestate-insurancecompliancenoticecited
• netintel-rpki-validate
  RPKI Route-Origin Validation for an IPv4 prefix and origin AS, computed per RFC 6811 from the bulk Validated ROA Payload set. Returns the ROA status, the covering ROA count and the matching ROAs with their origin, max length and trust anchor.
  rpkiroabgproutingroute-origin-validationrfc6811prefixasnsecurity
• netintel-asn-meta
  Registry and routing metadata for an autonomous system: the AS name, the Regional Internet Registry that allocated it, the country, the allocation date and status, a datacenter/hosting classification and the announced-prefix count.
  asnautonomous-systemrirallocationas-namebgproutingwhoisdatacenter
• netintel-prefix-report
  Full routing-security report for an IPv4 address or prefix: the origin AS, the RIR allocation of the block (who, when, country, status), the RPKI ROA status against that origin, and more-specific and less-specific ROA coverage.
  prefixipbgprpkiroarirallocationroutingorigindue-diligence
• catalyst-calendar
  Forward-looking FDA regulatory catalyst calendar for one biotech issuer, extracted from primary SEC 8-K and 6-K filings. Give a ticker or CIK and get upcoming PDUFA target action dates, advisory committee meetings, Complete Response Letters, priority reviews and PDUFA extensions, each date grounded in a quote from the filing and cited to its accession and EDGAR URL.
  biotechpdufafdacatalystadcommadvisory-committeecrlregulatorysec8-k6-kevent-drivencalendartickercik
• catalyst-upcoming
  Market-wide upcoming FDA regulatory catalysts across recent SEC 8-K and 6-K filings in a forward window. Get PDUFA dates, advisory committee meetings and other regulatory events for many biotech issuers at once, each grounded in a filing quote and cited to its accession and EDGAR URL. Bounded fan-out.
  biotechpdufafdacatalystadcommregulatorysec8-k6-kevent-drivencalendarmarket-widescreening
• catalyst-filing
  Extract every cited FDA regulatory-decision date from ONE SEC filing. Give an accession with its CIK, or a ticker or CIK to use the most recent matching 8-K or 6-K, and get all PDUFA, advisory committee, CRL, priority review and PDUFA extension dates in that document, each grounded in a quote. Cheap single-document pull.
  biotechpdufafdacatalystsec8-k6-kfilingaccessionregulatorytickercik
• threat-ioc-enrichment
  Type-agnostic threat-intelligence enrichment for a SOC or DFIR agent. Give one indicator of compromise of any kind — a file hash, IP, domain, URL or CVE id — and get one normalized, cited verdict. Auto-detects the type, dispatches to the right grain, fuses the sources and returns a verdict, an is_malicious flag, a confidence, malware family when known, per-source citations and reasons. Not a guarantee.
  threat-intelligenceiocsocdfirmalwarereputationhashipdomainurlcveenrichmenttriagesecurity
• threat-hash-reputation
  File-hash reputation and known-file context for a SOC or DFIR agent. Give an md5, sha1 or sha256 hash and get CIRCL hashlookup known-file status, a hashlookup trust score and file metadata (name, size, mimetype, source, database), plus malware family when a licensed feed is enabled. A known distribution or system file lowers the alert priority; an unknown hash is not itself evidence of malice. Indicators, not a guarantee.
  threat-intelligencehashmalwarefile-reputationhashlookupknown-filewhitelistnsrlsocdfirsecurity
• edu-screen
  Screen a US college or university name against the federal DAPIP database: fuzzy name search returning ranked institution candidates, each with its DAPIP id, OPEID, IPEDS unit id, state and an accredited flag. Cheap first step before edu/verify.
  educationaccreditationuniversitycollegescreeningdiploma-millverificationdue-diligencehiringdapip
• edu-accreditor
  Check whether an accrediting agency is recognized by the US Department of Education. Give an accreditor name and get back a recognized flag plus the matched agency, its type (institutional or programmatic), Title IV gatekeeper status, active status and recognition year. The direct fake-accreditor test.
  educationaccreditoraccreditationrecognizeddiploma-millverificationdue-diligencedapiptitle-iv
• edu-verify
  Verify a US college or university is accredited and get a diploma-mill verdict. Give one of name, opeid, ipeds or domain plus an optional claimed_accreditor; get back an is_accredited flag, the recognized accreditors, a diploma_mill_flag with weighted signals, operating status, a confidence and cited sources. Deterministic, no LLM.
  educationaccreditationdiploma-milluniversityverificationdue-diligencehiringdapip
• governance-proposals
  List a DAO's governance proposals from Snapshot, normalized into one schema: id, title, state, choices, per-choice scores, scores_total, quorum, vote count, start/end, author, snapshot block, strategies and a link-back. Filter by state; pass a Snapshot space-id or a known protocol alias.
  daogovernancesnapshotproposalsvotingquorumdelegatesonchaincryptoweb3
• governance-proposal
  One Snapshot proposal plus DETERMINISTIC governance semantics (no LLM): quorum progress and whether quorum is met, the leading choice and its margin, participation (votes and total voting power), seconds remaining, an honest outcome projection (current leader, not a final result), the top voters, and a structured digest.
  daogovernancesnapshotproposalquorumoutcomedelegatesvoting-powercryptoweb3
• governance-votes
  Normalized votes on a Snapshot proposal, ordered by voting power: voter address, resolved choice label, voting power, reason and timestamp. Tracks delegate participation and voting behaviour.
  daogovernancesnapshotvotesdelegatesvoting-powerparticipationcryptoweb3
• governance-space
  A Snapshot space's config and context so an agent understands the voting RULES: name, about, network, token symbol, strategies, admins/moderators, voting delay/period/quorum/type, proposal and follower counts, and a breakdown of active/pending/closed proposals.
  daogovernancesnapshotspacequorumstrategiesvoting-rulescryptoweb3
• crime-location
  Crime-risk verdict for a US location from public FBI UCR and NIBRS data. Give an address, a latitude and longitude, an agency ORI code, or a state, and get a 0-100 crime risk score, a low, medium, high or critical rating, a violent and property breakdown, a multi-year trend and a comparison with the national baseline, citing the reporting agency and the data as-of date. Deterministic, no AI. Aggregate risk indicators, not a consumer report.
  crimepublic-safetylocation-riskunderwritinginsurancereal-estaterelocationdue-diligencefbiucrnibrsrisk-scoresafety
• crime-agency
  Normalized crime profile for one FBI reporting agency by ORI code. Give an ORI and an optional offense and get the agency's multi-year annualized offense rates per 100,000 people, the latest complete reporting year, the trend and the data as-of date. The raw grain behind crime/location, without geocoding.
  crimepublic-safetyfbiucrnibrsagencyorioffense-ratesdue-diligence
• crime-benchmark
  National or state baseline crime rates for an offense and window from public FBI UCR and NIBRS data. Give an offense and an optional 2-letter state and get the annualized rate per 100,000 people by year, for anchoring a local score. Deterministic, no AI.
  crimepublic-safetyfbiucrnibrsbenchmarkbaselinenationalstateoffense-rates
• crime-incidents
  Recent incident density for a supported US city from its open-data portal. Give a city slug and an optional look-back window in days and get aggregated counts of reported incidents by offense category, a fresher signal than the lagged federal data. Counts by type, not a per-incident dump.
  crimepublic-safetyincidentscityopen-datasocratadensityrecent
• laborwage-prevailing
  US prevailing-wage determination for an occupation and location: the DOL OFLC four-tier level wages (Level 1 to 4) plus the average, hourly and annualized, with the geographic level, wage year and citation. Resolves the occupation by SOC code, O*NET code or free text and the location by OFLC area, county and state, or metro-area name. Optionally flags whether an offered wage meets the prevailing level.
  prevailing-wagelaborwagesoconeth1bpermlcaimmigrationdolcompensation
• laborwage-occupations
  Resolve an occupation title to ranked SOC candidates, each with the SOC code, official title and a match score. The cheap first step before a prevailing-wage determination when only a job title is known.
  sococcupationonetwagelaborlookupdisambiguation
• laborwage-areas
  Resolve a US location to ranked OFLC wage-area candidates, each with the area code, area name and state. Accepts a county with state, or a city or metro name. The cheap first step to find the area code for a prevailing-wage lookup.
  arealocationcountymsawagelaborgeographylookup
• laborwage-employer
  Employer labor-certification track record from public OFLC case-disclosure data: application counts by program, certified, denied and withdrawn rates, offered-wage range, top occupations and a flag for offered wages below the prevailing wage. Query by employer name or by SOC, state and fiscal year.
  employerh1blcapermlabor-certificationdisclosureimmigrationdoltrack-record
• fda-screen
  Search FDA-regulated manufacturers in the public FDA establishment records by firm name and get ranked facility candidates, each with its FDA FEI number, location, product types, inspection count and latest inspection classification. Cheap first step before fda/facility.
  fdagmpmanufacturerestablishmentinspectioncompliancedue-diligencesupplier-qualificationsupply-chainpharmadrugdevicesearch
• fda-facility
  GMP compliance-risk dossier for an FDA-regulated manufacturer from public FDA records. Give an FDA FEI number or firm name and get a 0-100 compliance risk score, a low, medium, high or critical rating, the inspection-classification history, warning letters and enforcement actions, Form-483 citations and import refusals, per-dimension signals and cited FDA record links. Deterministic, no LLM. Risk indicators, not legal or regulatory advice.
  fdagmpmanufacturerinspectionwarning-letterform-483import-refusalcompliancerisk-scoredue-diligencesupplier-qualificationsupply-chainesgpharmadrugdevice
• fda-inspections
  FDA inspection history for a manufacturer from public FDA records. Give an FDA FEI number or firm name and get the inspection classifications (Official, Voluntary or No Action Indicated) with the trend, plus the Form-483 observation citations with their cited CFR clause and short description. Deterministic, no LLM. Risk indicators, not legal or regulatory advice.
  fdagmpinspectionclassificationform-483citationmanufacturercompliancedue-diligencepharmadrugdevice
• fda-enforcement
  FDA enforcement history for a manufacturer from public FDA records. Give an FDA FEI number or firm name and get the compliance actions (warning letters, injunctions, seizures and consent decrees) plus the import refusals at the US border, each with its date and product. Deterministic, no LLM. Risk indicators, not legal or regulatory advice.
  fdaenforcementwarning-letterinjunctionseizureimport-refusalmanufacturercompliancedue-diligencesupply-chainpharmadrugdevice
• aircraft-registration
  Look up a US-registered aircraft in the public FAA Aircraft Registry by tail number (N-number) or serial and get a normalized record: registration status, registered owner, make, model, year, serial, engine, airworthiness date, type certificate and Mode-S code. Cheap first step before aircraft/diligence.
  aircraftfaan-numbertail-numberregistrationaviationassettitledue-diligenceownershipairworthinesslookup
• aircraft-diligence
  Title and airworthiness due-diligence verdict for a US-registered aircraft from the public FAA Aircraft Registry. Give a tail number or serial and get a 0-100 title risk score, a low, medium, high or critical rating, a clear_to_transact flag, per-dimension signals, reasons and the cited registry fields. Deterministic, no LLM. A diligence signal, not a certified title search.
  aircraftfaatitletitle-riskrisk-scoreairworthinessaviation-lendingaircraft-purchaseinsurance-underwritingescrowasset-verificationdue-diligenceclear-titlen-number
• aircraft-owner
  List the US-registered aircraft held by an owner name in the public FAA Aircraft Registry (fleet lookup). Give an owner or company name and get the matching aircraft, each with its tail number, serial and make and model. Registry metadata only. A diligence signal, not a certified title search.
  aircraftfaaownerfleetoperatoraviationregistrationasset-verificationdue-diligencen-numberownershipsearch
• bankhealth-screen
  Search US FDIC-insured banks by name and get ranked candidate institutions, each with its FDIC certificate number, active status, charter class, city and state and headline assets, deposits and return on assets. Cheap first step before bankhealth/verdict.
  bankbank-healthfdicdepositorycounterparty-risktreasuryfinancial-institutionresolvesearchdue-diligencecert
• bankhealth-verdict
  Financial-health verdict for a US FDIC-insured bank from public call-report data. Give a bank name or FDIC cert number and get a 0-100 health score (HIGHER is HEALTHIER), an A-F letter grade, derived proxy metrics (capital ratios, Texas-ratio proxy, uninsured-deposit exposure, ROA trend) and per-dimension signals, grounded to the reporting date. Deterministic proxies, no LLM, not CAMELS. Not financial advice.
  bankbank-healthfdicdepositorycounterparty-risktreasurycapital-ratiotexas-ratiouninsured-depositshealth-scoresolvencydue-diligencefinancial-institution
• bankhealth-failures
  History of US bank failures and assisted acquisitions from the public FDIC failed-bank list. Filter by bank name, FDIC cert number, 2-letter state or year and get matching records with the failure date, resolution type, city and state and the deposits, assets and estimated cost at failure. Covers the 2023 failures including Silicon Valley, Signature and First Republic.
  bankbank-failurefdicdepositorycounterparty-riskassisted-acquisitionresolutiondue-diligencehistoryfinancial-institution
• stableintel-list
  Catalog of covered stablecoins ranked by market cap, from the DefiLlama stablecoins feed. Each row carries symbol, name, DefiLlama id, peg type, collateral mechanism, total circulating supply, current price and the chains it lives on. Optionally filter by collateral mechanism or by chain. The cheap first step that resolves a symbol to the id the other routes use.
  stablecoinstablecoinslistcatalogpegcollateraldefillamausdcusdtdaimarket-capcrypto
• stableintel-profile
  Full stablecoin risk profile for a symbol, or a contract address with its chain. Fuses identity and collateral mechanism, the peg (price, deviation from one dollar and a depeg status), supply (total and per-chain circulating with an independent on-chain totalSupply cross-check and a divergence flag), known contract addresses, and a deterministic 0-100 depeg-risk score with rating and per-signal reasons.
  stablecoindepegrisk-scorepegreservescollateralsupplyon-chainverificationusdcusdtdaiprofilecrypto
• stableintel-peg
  Peg facet for a stablecoin: current price, the absolute deviation from the one-dollar peg, a coarse depeg status of stable, watch or depegged, and the collateral mechanism with a note. The cheap grain for monitoring whether a dollar token is holding its peg. Cited to the open-data source.
  stablecoinpegdepegpricedeviationmonitorusdcusdtdaicrypto
• stableintel-supply
  Supply facet for a stablecoin: total circulating supply plus the per-chain breakdown from DefiLlama, cross-checked against an INDEPENDENT on-chain ERC-20 totalSupply read of the curated contract, with a divergence flag when the two disagree beyond a tolerance. Cited to both the open-data source and public on-chain state.
  stablecoinsupplycirculatingper-chainon-chaintotalsupplyverificationdivergenceusdcusdtdaicrypto
• holdings-manager
  Normalized Form 13F portfolio for an institutional manager. Give a CIK or name and get consolidated positions: issuer, CUSIP, ticker, shares, value in US dollars, percent of portfolio, voting authority, plus portfolio total, top positions, concentration and spot Bitcoin and Ether ETF exposure, cited to the filing accession and period.
  13finstitutionalholdingsownershipsechedge-fundportfolioconcentrationbitcoin-etfethereum-etfcrypto-etfcusipmanagerdue-diligence
• holdings-changes
  Quarter-over-quarter change of an institutional manager's Form 13F portfolio. Give a CIK or name and get every position bucketed as new, added, reduced, sold out or unchanged, with per-position share and dollar deltas and a net flow summary, from two consecutive 13F filings, cited to both.
  13finstitutionalholdingschangesquarter-over-quarterflowbuyssellssechedge-fundportfoliocrypto-etfcusip
• holdings-filing
  One Form 13F filing normalized: the cover page plus every consolidated position with issuer, CUSIP, ticker, shares, value in US dollars, percent of portfolio and voting authority. Give an accession with its CIK, or a CIK or name with a quarter. A cheap granular pull.
  13finstitutionalholdingsfilinginformation-tablesecportfoliocusipaccession
• holdings-security
  All institutional holders of one security in a quarter, by ticker or CUSIP, with concentration and quarter-over-quarter institutional flow. This reverse index is deferred on this deployment and returns availability status; a manager's crypto ETF exposure is covered now by the holdings manager route.
  13finstitutionalholdersownershipsecurityreverse-indexconcentrationcrypto-etftickercusip
• unlock-calendar
  Forward-looking token unlock and vesting calendar for one crypto token. Give a ticker, name or slug and get the next unlock (date, token amount, USD value, percent of circulating supply), the full list of upcoming cliff and linear unlocks in a window, the allocation split across team, investors, ecosystem and community, supply metrics and a deterministic 0-100 supply-overhang score. Data from DeFiLlama, cited.
  cryptotokenunlockvestingemissionstokenomicssupplycliffcalendarcatalystsupply-shockoverhangdefillamatickertrading
• unlock-next
  The single next token unlock for one crypto token, cheapest actionable signal. Give a ticker, name or slug and get just the next scheduled unlock (date, token amount, USD value, percent of circulating supply, unlock type) plus the token's recent emission velocity over 24 hours, 7 days, 30 days and one year. Data from DeFiLlama, cited.
  cryptotokenunlockvestingemissionsnext-unlocktokenomicssupplyemission-ratedefillamatickertradingsignal
• unlock-upcoming
  Market-wide screener of the biggest upcoming token unlocks across many crypto tokens in a forward window. Returns the largest scheduled unlocks ranked by USD value or by percent of circulating supply, each with its date, token amount and protocol. Bounded fan-out across the most active emitters. Data from DeFiLlama, cited.
  cryptotokenunlockvestingemissionsscreenermarket-widesupply-shocktokenomicscalendardefillamatradingranking
• cex-solvency
  Centralized-exchange (CEX) solvency / proof-of-reserves counterparty-risk verdict in one call: given an exchange name, returns reserve totals, own-token concentration (the FTX/FTT pattern), clean-asset ratio, netflow stress, leverage and a deterministic 0-100 solvency_score with a rating, risk flags and a peer rank. Fused from the keyless DefiLlama CEX Transparency reserve aggregate. Reserves are a PROXY: customer liabilities and PoR-attestation quality are not visible.
  cexexchangesolvencyproof-of-reservesreservescounterparty-riskcustodynetflowown-tokenftxcryptorisk-score
• cex-reserves
  Cheap raw normalized reserve breakdown of one centralized exchange: total on-chain reserves (currentTvl), clean-of-own-token reserves (cleanAssetsTvl), the own-token symbol / USD value / concentration, clean-asset ratio, spot & derivative volumes, leverage, 24h/1w/1m netflow and the public reserves URL, with citations. The cheap first grain before the fuller /cex/solvency verdict. Keyless DefiLlama source; reserves are a proxy, not proof of solvency.
  cexexchangereservesproof-of-reservestvlown-tokennetflowcryptocustody
• cex-screen
  Market-wide ranked solvency screen of all centralized exchanges from DefiLlama CEX Transparency: each row has solvency_score, rating, clean-asset ratio, own-token concentration, 1-week netflow percent and risk flags. Filter by min_score / max_own_token_pct / min_tvl; sort by score, tvl or outflow. Deterministic; reserves are a proxy, not proof of solvency.
  cexexchangesolvencyscreenrankingreservesown-tokennetflowcustodycryptocounterparty-risk
• funding-profile
  Received R&D-funding profile of a company, organization or principal investigator, fused from NIH RePORTER, NSF and SBIR/STTR public records. Give a company or organization or PI name and get every federal research award it received with amounts, agencies, years, tech focus and abstracts, plus computed aggregates: total non-dilutive funding, breakdown by agency and by year, technology clusters, and active-award count.
  fundinggrantsrndr-and-dnihnsfsbirsttrnon-dilutivebiotechventure-capitaldue-diligencecompetitive-intelligencereportercompanypi
• funding-search
  Find federally funded R&D projects by technology topic across NIH RePORTER and NSF. Give a keyword such as a mechanism, disease area or technology and get a ranked list of funded projects with the recipient organization, principal investigator, agency, amount, year and abstract, for competitor-landscape mapping and lead generation. Bounded scan with a coverage note.
  fundinggrantsrndnihnsfsbirtopiclandscapecompetitive-intelligencelead-generationtechnologykeywordsearchbiotech
• funding-award
  Fetch one federal R&D award as a normalized record with its full abstract. Give the award identifier and its source (NIH project number, NSF award id, or SBIR award) and get the title, complete abstract, agency, amount, dates, principal investigators, organization and technology terms, plus for NIH the linked publication PubMed ids. Cheap single-record pull.
  fundinggrantsrndnihnsfsbirawardproject-numberabstractpublicationspmidlookup
• mining-hashprice
  Bitcoin mining hashprice: expected mining reward per petahash and per terahash per second per day, in BTC and USD, fused with the network hashrate, current difficulty, the next difficulty-retarget forecast and the block-subsidy and average-fee split. Informational, not advice.
  bitcoinbtcmininghashpricedifficultyhashraterewardeconomicshashrate-index
• mining-breakeven
  ASIC-miner break-even and profitability: daily and monthly BTC and USD revenue, power cost, net profit, margin, the break-even electricity price and the break-even BTC price, and optional hardware payback days, for a named miner model or raw hashrate and wattage at a given electricity price. Informational, not advice.
  bitcoinbtcminingbreakevenasicprofitabilityelectricityantminerwhatsminer
• mining-capitulation
  Bitcoin hash-ribbon miner-capitulation signal: the 30-day versus 60-day moving average of network hashrate, whether miners are in capitulation, whether a recovery cross has occurred, and the 30-day hashrate trend. Informational, not advice.
  bitcoinbtcmininghash-ribboncapitulationhashratesignaltrendtrading
• derivs-funding
  Perpetual-swap funding rates for an asset fused across decentralized venues (Hyperliquid, dYdX v4): each venue's current funding plus an open-interest weighted aggregate funding rate, annualized APR, the cross-venue spread and dispersion. One normalized call instead of polling each protocol and reconciling funding intervals yourself.
  funding-rateperpetualsderivativescryptohyperliquiddydxdefiaprcarrycross-venuepositioningintelligence
• derivs-oi
  Open interest for a perpetual asset across decentralized venues (Hyperliquid, dYdX v4): per-venue open interest in coins and in USD notional (via each venue's mark or oracle price), the total aggregate USD open interest and each venue's share. One call, normalized across protocols.
  open-interestperpetualsderivativescryptohyperliquiddydxdefinotionalleveragecross-venueliquidityintelligence
• derivs-basis
  Perpetual basis for an asset: the mark-versus-oracle premium on venues that publish a native mark price (Hyperliquid), in basis points, with a naive annualized carry proxy. Shows how far the perpetual trades from the underlying oracle — a froth and leverage-cost signal.
  basispremiumperpetualsderivativescryptohyperliquidcarrymark-priceoracledefiarbitrageintelligence
• derivs-positioning
  Fusion positioning brief for a perpetual asset in ONE call: aggregate funding and APR, aggregate open interest, mark-vs-oracle basis, cross-venue funding spread, a funding-flip trend from Hyperliquid history, and a deterministic 0-100 squeeze/positioning score with a verdict and crowding direction. Saves several protocol calls plus the normalization and scoring.
  positioningsqueezefunding-rateopen-interestbasisperpetualsderivativescryptohyperliquiddydxfusionintelligence
• timing-ahr999
  Bitcoin AHR999 accumulation index: (spot / 200-day geometric mean) * (spot / exponential-growth valuation), with the accumulation zone (bottom / dca / wait), the raw components and a short interpretation. Keyless, computed from DefiLlama price history.
  cryptobitcoinahr999dcavaluationaccumulationmarket-timingindicatoron-chain
• timing-indicators
  Bitcoin valuation dashboard in one call: AHR999, Mayer Multiple, 200-week MA deviation and Pi-Cycle Top proximity, each with its own zone and signal. MVRV is an honest gated scaffold (no keyless source). Keyless, computed from DefiLlama daily and weekly price history.
  cryptobitcoinvaluationmayer-multiplepi-cycle200wmaahr999dashboardmarket-timingcycle
• timing-dca
  Normalized Bitcoin DCA verdict: a single accumulate / hold / reduce signal with confidence and rationale, fusing AHR999, the Mayer Multiple, the Fear & Greed index and the 200-week MA deviation. Shows the input components and per-indicator scores. Keyless, deterministic, no LLM.
  cryptobitcoindcasignalaccumulatemarket-timingfusionfear-greedahr999verdict
• timing-fng
  Crypto Fear & Greed index with a market-timing trend: current value and classification, 7-day and 30-day deltas, streak in the current regime, 30-day min and max, and a contrarian flag on extreme fear or greed. Keyless.
  cryptobitcoinfear-greedsentimentmarket-timingindexcontrariantrendmood
• lending-rates
  Cross-protocol DeFi money-market supply/borrow rates for an asset on Base: per-market supply APY, borrow APY, reward APY, utilization, LTV and available liquidity across Aave/Compound/Morpho/Euler/Fluid/Moonwell, plus a risk-aware best-safe-yield ranking (safety-flagged, not naked max APY), fused by us from DefiLlama pools+lendBorrow.
  defilendingmoney-marketratesapysupplyborrowyieldaavecompoundmorphoutilizationonchainbase
• lending-markets
  DeFi lending protocol-health + solvency intelligence for a protocol or asset on Base: per-market utilization, available liquidity, TVL, total borrowed, debt ceiling and a deterministic 0-100 health score plus verdict (healthy / tight-liquidity / elevated), protocol aggregates, and a rate/TVL trend — computed by us over DefiLlama data.
  defilendingprotocol-healthsolvencyrisktvlutilizationscoreaavemorphobase
• lending-liquidations
  On-chain DeFi liquidation telemetry for Base lending protocols: recent LiquidationCall events decoded by us from public Base event logs — count, total debt repaid and collateral seized (USD), estimated liquidation bonus, per-protocol and per-asset breakdown, and the recent events (user, liquidator, collateral, debt).
  defilendingliquidationriskhealth-factoraavecompoundmorphoonchainbasetelemetry
• bridge-screen
  Cross-chain bridge safety screen: given a bridge (Stargate, Across, Wormhole, Arbitrum, CCTP, ...), returns a deterministic 0-100 risk score and a safe/caution/avoid verdict fusing its trust model, TVL depth, exploit history and governance/upgrade risk, with the reasons. One call instead of reconciling L2Beat, DefiLlama TVL and hack post-mortems yourself.
  bridgecross-chainsafetyrisk-scoretrust-modelexploit-historytvldefiroutinginteroperabilityl2beatintelligence
• bridge-exploits
  Bridge exploit track record: for one bridge, its hack history (incidents, total USD lost, funds returned, worst technique); with no bridge, a ranked leaderboard of every bridge hack by USD lost. Sourced from DefiLlama's hack dataset, joined and normalized by us.
  bridgeexploithacksecuritycross-chainpost-mortemlossdefitrack-recordleaderboardriskintelligence
• bridge-tvl
  Bridge TVL and per-chain liquidity concentration: total value locked plus the breakdown across chains and the largest single chain's share, from DefiLlama. A liquidity-depth and concentration signal for routing decisions.
  bridgetvlliquiditycross-chainconcentrationdefidepthroutingdefillamacapitalriskintelligence
• bridge-route
  Corridor safety verdict: given a source chain, destination chain and optional asset/amount, returns every bridge covering that corridor, each with its deterministic risk score and safe/caution/avoid tier, sorted safe-first, plus the recommended bridge and the reasons. One call to pick the safest bridge for a hop.
  bridgeroutecorridorcross-chainroutingsafetyrisk-scorerecommendationdefiinteroperabilityagentintelligence
• ucc-debtor-encumbrance
  Secured-lending due-diligence for a business. Give a company name and a state and get its encumbrance profile: which secured creditors hold liens on its assets, the active UCC-1 financing statements plus federal, state and municipal tax liens, judgment and labor liens, each with a computed effective status, and a summary with the active secured-creditor count and distress signals. Cited to the official state open-data portal. Informational public record, not a credit decision.
  uccliensecured-lendingencumbranceunderwritingcredit-riskdue-diligencefinancing-statementtax-lienjudgment-lienbusinesskybb2b-credit
• ucc-creditor-portfolio
  Reverse lien lookup by secured party. Give a lender or creditor name and a state and get the business debtors on which that party currently holds active liens — their lien portfolio in that state, for competitive intelligence or counterparty mapping. Cited to the official state open-data portal. Informational public record.
  uccliensecured-partycreditorlenderportfoliocompetitive-intelligencefinancing-statementbusinessb2b
• trader-perps
  Open Hyperliquid perpetual positions for an EVM address: per-position direction, size, USD notional, leverage, entry, mark, unrealized PnL, ROE and liquidation price, PLUS derived signals — distance-to-liquidation, account leverage, aggregate unrealized PnL, concentration and a deterministic 0-100 liquidation-risk score. Follow-the-smart-money wallet intelligence in one call. public on-chain data, not financial advice.
  hyperliquidperpspositionswalletaddressliquidationleveragesmart-moneydefion-chainintelligence
• trader-polymarket
  Polymarket wallet intelligence for an EVM address: open positions (title, outcome, size, avg vs current price, current value, realized + unrealized PnL, redeemable), portfolio value, recent trade activity, and derived totals plus size-weighted conviction, concentration and a realized-win proxy — positions, value and activity fused into one brief. On-chain USDC markets on Polygon. public on-chain data, not financial advice.
  polymarketwalletpositionspnlprediction-marketaddresson-chainportfoliointelligence
• trader-vaults
  Hyperliquid vaults, two modes in one route: pass `vault` (an address) for a single vault overview — name, leader, TVL, APR, age, max drawdown, pnl trend and a deterministic 0-100 quality score; or omit it for a ranked discovery list of the top open vaults by `sort` (tvl or apr). public on-chain data, not financial advice.
  hyperliquidvaulttvlapryieldstrategydefion-chainintelligence
• smartmoney-leaderboard
  Follow the smart money: a ranked leaderboard of the TOP TRADERS on Hyperliquid by `window` (day/week/month/allTime) and `sort` (PnL, ROI or volume), each with account value and a consistency signal. Includes a human-readable `summary` and structured `leaders`; follow=true adds the top address's open positions. public on-chain data, not financial advice.
  smart-moneyleaderboardtop-tradershyperliquidpnlroirankingfollow
• pkg-preflight
  Install-safety preflight for one dependency BEFORE pip install / npm i. Returns a safe / caution / block verdict fusing existence, OSV malware flags, typosquat distance to a popular package, a known-hallucination corpus, and freshness metadata. Supply-chain indicators, not a guarantee.
  supply-chainsecurityslopsquattyposquatmalwaredependenciesnpmpypiagentpreflight
• pkg-preflight-batch
  Batch install-safety preflight for a whole dependency list or parsed manifest (up to 100 packages). Returns a verdict per package plus a blocked / caution / safe summary. Supply-chain indicators, not a guarantee.
  supply-chainsecurityslopsquattyposquatmalwaredependenciesmanifestbatchnpmpypiagent
• license-check
  License-compliance verdict for one package and its whole transitive dependency tree. Resolves the deps.dev graph plus the declared SPDX license of every node, finds copyleft contamination points, and returns a target-and-distribution-aware verdict of safe, attribution-required, copyleft-risk or incompatible. Automated indicators, not legal advice.
  licensecompliancecopyleftspdxopen-sourcegplagpllgpldependenciessbomattributiondue-diligence
• license-scan
  License-compliance verdict for a whole dependency list or parsed manifest in one call. Accepts name-at-version strings, a parsed package.json, a requirements.txt list or go.mod imports, resolves each declared SPDX license, and returns a per-dependency plus aggregate verdict with the worst copyleft contamination point. Automated indicators, not legal advice.
  licensecompliancecopyleftspdxmanifestsbomgplagpldependenciesscanattributiondue-diligence
• license-compat
  Pure-compute license-compatibility verdict, no network. Give a list of SPDX ids or one SPDX expression with AND, OR and WITH plus a target license and a distribution model, and get the matrix verdict of safe, attribution-required, copyleft-risk or incompatible with the obligation and reasons. Automated indicators, not legal advice.
  licensecompatibilityspdxcopyleftcomputegplagpllgplmatrixattributioncompliance
• docs-library
  Up-to-date, version-pinned documentation for a library or API, for coding agents. Give an ecosystem and a package name (optional version and topic) and get a compact doc slice: package identity (latest and requested version, license, repo, homepage and doc URLs, version list) plus the README or llms.txt section matching the topic, each with a provenance citation. Keyless PyPI, npm, crates and GitHub sources.
  docsdocumentationlibraryapicoding-agentversion-pinnednpmpypicratesgithubcontext7readmereference
• docs-snippet
  Working code snippets for a library, matched to a topic. Give an ecosystem, package name and a topic or symbol and get the fenced code blocks from the README or docs whose language, code or nearest heading matches, each with a source citation and an honest truncated flag. Ideal for grounding a coding agent in real usage examples.
  docscodesnippetexamplecoding-agentusagesamplenpmpypicratesgithubreference
• docs-changelog
  Version-delta changelog for a library between two versions. Give an ecosystem, package name and from_version and to_version and get the GitHub release notes in that range, the registry versions between them, and surfaced breaking-change markers. Built for agents deciding whether an upgrade is safe.
  docschangelogrelease-notesversionupgradebreaking-changescoding-agentdiffnpmpypicratesgithub
• answer
  Cited answer (RAG): a natural-language question is answered by searching the public web, reading the top pages and synthesizing a grounded answer with a list of source URLs. Answer cites only the retrieved sources (anti-hallucination).
  answercitedragresearchquestionsynthesissourceswebcitations
• news-brief
  Situation brief on a topic (RAG over fresh news): searches recent news, reads the top articles and synthesizes a short cited summary of what is currently happening plus key points. Cites only the retrieved articles (anti-hallucination).
  newsbriefsituationsummaryanalysiscurrent-eventsresearchsynthesiscitedfresh
• rwa-list
  Catalog of tokenized real-world-asset products ranked by TVL, from the DefiLlama RWA universe. Each row carries slug, name, symbol, normalized sub-category, backing type, issuer, DefiLlama category, total value locked and the chains it lives on. Optionally filter by sub-category, chain or issuer. The cheap first step that resolves a name to the slug the other routes use.
  rwatokenizedreal-world-assetlistcatalogtreasuryprivate-credittvlissuerdefillamacrypto
• rwa-product
  Full tokenized-RWA product profile for a slug, a token symbol, or an issuer with a name. Fuses identity and issuer, the normalized sub-category and backing type, on-chain TVL with a per-chain distribution, a growth trend of TVL over 7, 30 and 90 days, pool-level yield and APY, and an independent on-chain totalSupply cross-check for a curated token, with cited sources and a derived-signal frame.
  rwatokenizedreal-world-assetprofiletvlyieldapybackingissueron-chainverificationtreasurycrypto
• rwa-yield
  Yield facet for a tokenized-RWA product: pool-level APY, base APY, reward APY, the 30-day mean APY and the 30-day change, plus a TVL-weighted average across the product's pools, from the DefiLlama yields feed. Reports availability false when the product has no tracked pools. Cited to the open-data source.
  rwatokenizedyieldapypoolstreasuryprivate-creditdefillamacrypto
• rwa-category
  Market-intelligence aggregate over a normalized RWA sub-category: total TVL, the top products ranked with their TVL share, issuer concentration and the leading product's growth trend. Called without a category it returns a market-wide roll-up of every sub-category's TVL and product count. Cited to the open-data source.
  rwatokenizedcategorymarketaggregatetvlissuerconcentrationtreasuryprivate-creditdefillamacrypto
• model-route
  Pick the cheapest LLM that passes your task and constraints. Give a task class and optional constraints such as minimum context, required tool-use, vision or reasoning, maximum input and output price per million tokens, a minimum coding benchmark and a provider filter, and get a ranked cheapest-first list of models that pass, plus a recommended pick and a deterministic rationale. Fused from open keyless catalogs LiteLLM, models dev and Aider with a citation on every model.
  llmmodel-routingmodel-selectionpricingbenchmarkcapabilitiescheapestagent-infracoding-agentorchestrationlitellmaider
• model-lookup
  Look up one normalized model record by name or short alias such as sonnet or 4o. Returns per-million input and output prices, context and output limits, capability tags, modalities, knowledge cutoff, release date, provider and coding benchmark, each fused from open keyless catalogs LiteLLM, models dev and Aider with a source citation. Unknown names return found false, never an error.
  llmmodelpricingcontext-windowcapabilitiesbenchmarkknowledge-cutofflookupaliaslitellmmodels-devaider
• model-compare
  Compare two to five models side by side. Give a comma separated list of names or aliases and get each model normalized on price, context, capabilities, knowledge cutoff and coding benchmark, plus flags for the cheapest, the best benchmark and the largest context. Fused from open keyless catalogs with a citation on every model.
  llmmodelcomparepricingbenchmarkcontext-windowcapabilitiesside-by-sidelitellmmodels-devaider
• personality-chart
  Multi-framework birth-chart in ONE call: western natal astrology, Vedic sidereal positions, Chinese BaZi, Pythagorean numerology, a neutral I-Ching bodygraph and biorhythms. Give a birth date (optional time, place or lat and lon, and tz or utc_offset) and get cited JSON across every system. Deterministic, no LLM, no keys.
  astrologybirth-chartnatalhoroscopevedicjyotishbazichinese-zodiacnumerologyhuman-designbodygraphbiorhythmself-knowledgepersonalityephemerismulti-system
• personality-western
  Western natal astrology only: tropical planet placements by sign and degree with retrograde flags, Whole-Sign houses, the Ascendant and Midheaven angles and the major Ptolemaic aspects. Give a birth date, and for the angles a time, place and tz or utc_offset. Deterministic ephemeris, no LLM, no keys.
  astrologynatalwestern-astrologyhoroscopezodiacplanetshousesaspectsascendantephemeris
• personality-bodygraph
  Neutral I-Ching bodygraph: the gate and line activations for the personality (birth) and design (Sun 88 degrees of arc before birth) sets, with the derived defined centers, channels, profile and a structural energy-type. Give a birth date, and for full accuracy a time, place and tz or utc_offset. Computed, not interpreted.
  bodygraphhuman-designi-chinggatescenterschannelsprofileenergy-typeself-knowledgeephemeris
• secret-scan
  Static scan of source code or config for hardcoded secrets and credentials. Detects cloud keys, VCS and CI tokens, payment keys, messaging tokens, AI-provider keys, database URIs with passwords, private keys and high-entropy generic secrets. Returns a go/no-go verdict (pass, caution, block) with per-finding rule, provider, severity and location. Secret indicators, not a guarantee.
  secretssecuritycredentialspre-commitscanneragentcode
• secret-diff
  Static secret scan of a unified git-diff, scoring ONLY added lines. The low-false-positive pre-commit mode: a secret already present in unchanged or removed code is ignored, only newly introduced credentials are flagged. Returns a verdict (pass, caution, block) with per-finding rule, provider, severity, file and line. Secret indicators, not a guarantee.
  secretssecuritygit-diffpre-commitscanneragent
• iac-scan
  Static misconfiguration scan of an infrastructure-as-code config: Terraform (plan JSON or HCL), Kubernetes / Helm, Dockerfile, docker-compose or CloudFormation. Detects public storage, open security groups, unencrypted data at rest, over-broad IAM, privileged / root containers, host mounts and more. Returns a verdict (pass, caution, block), a 0-100 risk score and per-finding rule, severity, resource, location and fix hint. Security indicators, not a guarantee.
  iacterraformkubernetescloudsecuritymisconfigurationdevopsscanneragent
• iac-inspect
  Static misconfiguration scan of a SINGLE infrastructure resource or config snippet (Terraform, Kubernetes, Dockerfile, docker-compose or CloudFormation). The lightweight per-resource form of /iac/scan: returns a verdict (pass, caution, block), a risk score and findings with rule, severity, location and fix hint. Security indicators, not a guarantee.
  iacterraformkubernetescloudsecuritymisconfigurationscanneragent
• code-scan
  Static application-security scan of source code or a git-diff for CWE Top-25 logic bugs: SQL injection, XSS, command injection, code and template injection, SSRF, path traversal, insecure deserialization, weak crypto, insecure randomness, open redirect and XXE across Python, JavaScript, TypeScript, Java and Go. Returns a go/no-go verdict with per-finding CWE, severity, file and line. Static indicators, not a guarantee.
  sastsecuritycodecwepre-commitscanneragent
• code-inspect
  Static application-security scan of a single code blob for CWE Top-25 logic bugs (SQL injection, XSS, command injection, SSRF, path traversal, insecure deserialization, weak crypto and more). Pass the code and its language; returns a verdict with per-finding CWE, severity and line. Static indicators, not a guarantee.
  sastsecuritycodecwescanneragent
• cicd-scan
  Static security scan of a CI/CD pipeline config: GitHub Actions, GitLab CI or CircleCI. Detects unpinned actions / images / orbs, template and environment injection, dangerous triggers, over-broad workflow-token permissions, secrets leaked to logs, cache poisoning and more. Returns a verdict (pass, caution, block), a 0-100 risk score and per-finding rule, severity, object, location and a concrete fix hint. Security indicators, not a guarantee.
  cicdgithub-actionsgitlabcirclecisecuritysupply-chaindevopspipelinescanneragent
• cicd-inspect
  Static security scan of a SINGLE CI/CD job or step snippet (GitHub Actions, GitLab CI or CircleCI). The lightweight per-object form of /ci/scan: returns a verdict (pass, caution, block), a risk score and findings with rule, severity, location and fix hint. Security indicators, not a guarantee.
  cicdgithub-actionsgitlabcirclecisecuritypipelinescanneragent
• a11y-preflight
  Static accessibility (WCAG 2.2) check of a UI markup fragment for JSX, TSX, Vue, Angular or HTML. Detects missing image alt, unlabeled form controls, buttons and links with no accessible name, skipped heading levels, invalid ARIA, non-interactive click handlers, duplicate ids, positive tabindex and low static colour contrast. Returns a pass, caution or block verdict with per-finding WCAG criterion, element and line. Accessibility indicators, not a legal compliance guarantee.
  accessibilitya11ywcagpreflightverdictagentui
• a11y-batch
  Batch static accessibility (WCAG 2.2) check of many UI files at once: a list of objects each with a filename, optional framework and markup. Returns a per-file pass, caution or block verdict plus a rollup with the worst verdict and totals by severity. Accessibility indicators, not a legal compliance guarantee.
  accessibilitya11ywcagbatchverdictagentui
• dbmigrate-check
  Safety preflight for a database schema migration BEFORE you apply it. Send the migration SQL for Postgres or MySQL and get a pass, caution or block verdict with per-finding operation, severity, plain-language reason and a zero-downtime alternative. Migration-safety indicators, not a guarantee.
  databasemigrationschemaddlpreflightverdictpostgresmysqldevopsagent
• dbmigrate-batch
  Batch safety preflight for many database migrations at once: a list of objects each with a name and migration SQL. Returns a per-file pass, caution or block verdict plus a rollup with the worst verdict and counts. Migration-safety indicators, not a guarantee.
  databasemigrationschemaddlbatchverdictpostgresmysqldevopsagent
• sqlscan-check
  Safety and performance preflight for a database query BEFORE you run it. Send the query for Postgres, MySQL or SQLite and get a pass, caution or block verdict with per-finding operation, severity, plain-language reason and a fix. Query-safety indicators, not a guarantee.
  databasesqlquerypreflightverdictsafetyperformancepostgresmysqlagent
• sqlscan-batch
  Batch safety and performance preflight for many database queries at once: a list of objects each with a name and query text. Returns a per-query pass, caution or block verdict plus a rollup with the worst verdict and counts. Query-safety indicators, not a guarantee.
  databasesqlquerybatchverdictsafetyperformancepostgresmysqlagent
• marketing-funnel
  Cross-channel conversion funnel over your ad data: per-stage conversion rate, drop-off, loss-rate, overall conversion, the bottleneck stage, and a per-channel breakdown. Pure computation over your inputs.
  marketingfunnelconversiondrop-offanalyticsattribution
• marketing-attribution
  Multi-touch attribution over conversion paths, five models at once: first-touch, last-touch, linear, time-decay, and position-based. Returns per-channel credit for each model plus a comparison. Pure computation over your inputs.
  marketingattributionmulti-touchfirst-touchtime-decayanalytics
• marketing-spend
  Per-channel unit economics from spend, conversions and revenue: CPC, CPM, CPA, CAC, ROAS, ROI, conversion rate, and LTV to CAC. Ranks channels and suggests a budget shift. Pure computation over your inputs.
  marketingspendroascacunit-economicsbudget
• marketing-experiment
  A/B test significance with a two-proportion z-test: observed lift, z-score, two-sided p-value, confidence interval on the lift, minimum detectable effect, and sample-size sufficiency. Pure computation over your inputs.
  marketingexperimentab-testsignificancep-valuestatistics
• dexswap-quote
  Non-custodial swap calldata for Base: give tokenIn, tokenOut, raw amountIn, slippage and recipient; we read Aerodrome and Uniswap V3 on-chain state, pick the max-output route, and return ready-to-sign transaction calldata plus the ERC-20 approval, amountOutMin, price impact and the venues compared. You sign with your own wallet — we never hold or move funds.
  swapdexcalldatanon-custodialbaseaerodromeuniswapdefiaggregatoron-chainerc20routing
• dexswap-price
  Lightweight swap quote for Base without calldata: give tokenIn, tokenOut and raw amountIn and get the max-output route across Aerodrome and Uniswap V3, the buy amount, amountOutMin, price impact and the venues compared. A cheap price check before you build the full transaction.
  swapdexquotepricebaseaerodromeuniswapdefion-chainroutingnon-custodial
• etf-flows
  Daily net creation/redemption flow for spot Bitcoin or Ethereum ETFs, computed from each issuer's own holdings disclosure: per-fund and total net flow in USD and coin for the latest day, a recent series and the window cumulative. One normalized call instead of polling each issuer site and differencing units.
  etfflowsbitcoinethereumspot-etfinflowsoutflowsinstitutionalibitcryptofund-flowsintelligence
• etf-holdings
  Latest holdings for spot Bitcoin or Ethereum ETFs from issuer disclosures: per-fund coin units (or shares), market value and shares outstanding, plus total AUM across funds and the largest fund's AUM share. One normalized call.
  etfholdingsaumbitcoinethereumspot-etfshares-outstandingassets-under-managementibitcryptoconcentrationintelligence
• etf-brief
  Fusion flow brief for spot Bitcoin or Ethereum ETFs in ONE call: latest total net flow, the inflow/outflow streak, the window cumulative, flow momentum, issuer concentration, total AUM and a deterministic accumulation, distribution or neutral verdict. Saves several issuer queries plus the differencing.
  etfflowsbriefbitcoinethereumspot-etfstreakmomentumaccumulationdistributionfusionintelligence
• evm-contract-source
  Fetch a verified smart-contract's full source, ABI, compiler settings and NatSpec docs for an EVM address, and automatically resolve a proxy to its implementation so the response also carries the implementation ABI. One call returns everything an audit or integration agent needs to understand the contract, keyless and pay-per-call. Unverified contracts are reported honestly.
  evmcontractsource-codeabiverifiedsourcifyproxyimplementationnatspecauditsoliditybaseethereum
• evm-contract-abi
  Fetch just the ABI of a verified EVM contract, resolving a proxy to its implementation ABI as well. A cheap slice for when you only need the interface to encode calls or decode data, not the full source. Unverified contracts are reported honestly.
  evmcontractabiverifiedsourcifyproxyimplementationinterfacebaseethereumarbitrum
• evm-event-logs
  Read a contract's recent event logs on an EVM network over a bounded block window and decode them. Logs are decoded from an event signature you supply, or from the contract's verified ABI, or by resolving the topic to a name via 4byte. Raw logs are always returned; decoded fields are added where possible.
  evmevent-logslogsgetlogsdecodeeventstopicbaseethereumarbitrumoptimismpolygon
• evm-decode-signature
  Reverse a 4-byte function selector, an event topic hash, or raw calldata into its human-readable signature using the 4byte database, with collisions resolved so the real signature (the oldest registered) is returned first and the attacker-registered lookalikes are flagged. Parameter types are parsed out.
  evmselectorsignature4bytedecodecalldatatopicfunctioneventcollisionabi
• evm-internal-tx
  List the internal transactions of an EVM transaction: the nested contract calls and their value transfers and call types, via Blockscout. Reveals the value flow and call tree that a plain receipt hides. Rate-limited upstream degrades gracefully rather than erroring.
  evminternal-transactionstracevalue-flowblockscouttransactioncallsbaseethereumarbitrumpolygon
• nft-floor
  Multi-chain NFT collection floor price in one call: floor in native currency AND USD, 24h floor change percent, market cap and the resolved source. EVM via CoinGecko (pass chain+contract or a CoinGecko slug), Solana + Bitcoin-Ordinals via Magic Eden (pass chain plus the marketplace symbol as slug). Keyless, attributed.
  nftfloor-pricefloorcollectionethereumsolanabitcoinordinalsmultichainmarket-data
• nft-collection
  Flagship NFT collection intelligence: fuses identity, floor (native+USD), market cap, volume, total supply, holders and listed count into COMPUTED metrics — liquidity ratio (listed/supply + volume/mcap), holder/supply ratio, sales velocity and floor momentum — plus a normalized market-health verdict with confidence and rationale. EVM via CoinGecko, Solana + Bitcoin-Ordinals via Magic Eden. Keyless, attributed.
  nftcollectionmarket-healthliquidityholdersfloorintelligencemultichainsolanaordinals
• nft-sales
  Recent NFT sales intelligence for a collection: 24h sale count, average sale price (native+USD), momentum versus floor and sales velocity. Live native trade feed on Solana and Bitcoin-Ordinals (Magic Eden activities); on EVM CoinGecko has no native feed so returns an honest partial (sales_feed_available=false) with the one-day aggregate. Never fabricates trades. Keyless, attributed.
  nftsalestradesvolumevelocitymomentumsolanaordinalsmultichainmarket-data
• social-trending
  What crypto tickers are heating up across crypto social right now: a ranked cross-source attention index fusing Farcaster cashtag mentions across curated crypto channels (keyless open-protocol hub) with crypto-news mention counts and a GDELT macro coverage-trend. Each row carries an attention score, a recent-vs-prior velocity, the channels driving it and cast sentiment — signal, not a raw feed. ToS-clean (no Twitter/Reddit).
  socialtrendingcryptofarcastersentimentattentionvelocitysignalmemecoinsbasecashtagsfusion
• social-sentiment
  Composite bull/bear sentiment for a crypto ticker or topic, fused across three ToS-clean sources: Farcaster cast sentiment (open-protocol hub), our crypto-news + Fear&Greed composite, and GDELT world-tone. Returns a normalized score, a per-source breakdown, 24h/7d deltas and a confidence (how much data is under the signal) — so you see which source drives it and how thin the signal is.
  sentimentcryptosocialfarcasternewsgdeltbullishbearishsignalfusionconfidencecomposite
• defiexec-build
  Non-custodial yield deposit/redeem calldata for Base: give protocol (aave-v3, compound-v3 or erc4626), asset or vault, raw amount, action and recipient; we read the protocol on-chain state and return ready-to-sign transaction calldata plus the ERC-20 approval (deposit only) and the expected shares or assets. You sign with your own wallet — we never hold or move funds.
  yielddeficalldatanon-custodialbaseaavecompounderc4626vaultlendingdepositredeemon-chain
• defiexec-preview
  Lightweight yield preview for Base without calldata: give protocol, asset or vault, raw amount and action and get the expected shares or assets and the safety flags (paused/frozen/cap, empty-vault inflation risk). A cheap check before you build the full transaction.
  yielddefipreviewbaseaavecompounderc4626vaultlendingon-chainnon-custodial
• sol-token-verdict
  Solana memecoin RUG-RISK verdict in one call: fuses on-chain mint/freeze authority, real holder concentration (bonding-curve, AMM pool vaults and burned tokens excluded), bonding-curve stage and LP-burn status into a normalized safe / caution / danger verdict with a 0-100 risk score, concrete flags, the component values and on-chain citations. Keyless, deterministic, no LLM.
  solanamemecoinpumpfunrugriskverdicttoken-safetybonding-curvetrencheson-chain
• sol-curve
  Solana bonding-curve graduation status from the on-chain curve account: graduation progress percent, SOL raised in the curve, SOL remaining to graduation, complete flag, the marginal curve price + market cap, and the graduation destination (PumpSwap). Cheap, deterministic, keyless — built for high-frequency polling.
  solanamemecoinpumpfunbonding-curvegraduationpricemarket-captrencheson-chainpolling
• sol-token-holders
  Solana token cap-table: the top holders with amounts and percentages, where the bonding-curve account, AMM/DEX pool vaults and the incinerator are LABELLED and EXCLUDED so real concentration is measured over the free float. Returns top1/top5/top10 percent of circulating, an HHI concentration index and a low-float warning.
  solanamemecoinholderscap-tableconcentrationdistributionwhaleshhitrencheson-chain
• sol-lp-strategy
  Best Solana liquidity-pool strategy for a token mint: finds the live LP pools holding the mint from keyless DefiLlama yields (Orca, Raydium, Kamino and other Solana venues), ranks them by TVL + fee-APY + 24h volume, and suggests a concentrated-liquidity price range from the pool's return volatility. Returns the best pool, alternatives, 24h fees and the suggested range.
  solanamemecoinlpliquiditymeteoraorcaraydiumyieldstrategyconcentrated-liquidity
• address-labels
  Identify what an EVM address IS in one keyless call: contract/protocol identity (entity, name, category) from Open Labels Initiative attestations with trusted-attester consensus, plus on-chain truth (is_contract, code_hash), reverse ENS/Basename, sanctions (OFAC/UK/EU/UN) and scam-drainer flags. Cited provenance; unknown addresses answer with empty labels, never a 404.
  addresslabelsentityidentityolisanctionsscamscreeningcontract
• sellerops-audit
  Diagnose why another x402 route does not settle or stays invisible in Bazaar. From the route URL: a verdict (ready / blocked / degraded) plus per-check findings each with a concrete fix, over the CDP settle-blockers (header size, WAF text, method honesty, canonical-USDC, real index membership, on-chain settle fact). Diagnostic indicators, not a guarantee.
  x402sellersettlediagnosticsbazaarpaymentsauditdiscoveryrevenue
• sellerops-settle-check
  Cheap iterate check for the CDP settle-blockers of an x402 route: the payment-required header size vs the empirical settle ceiling, WAF-tripping text and method honesty. One unpaid probe of the target. For a seller tweaking output_example and re-checking the header size without paying for a full audit. Diagnostic indicators, not a guarantee.
  x402sellersettlediagnosticspaymentsheader-sizewaf
• humanverify-create
  Get a HUMAN judgement on a subjective/culturally-nuanced question: we post the task to an account-free human rail, collect several answers, and return one typed verdict with an honest confidence (agreement × sample completeness). This create route returns a ticket immediately; poll the free result route for the verdict (human answers arrive asynchronously). Only judgement tasks are accepted — engagement/astroturf, captcha, PII and professional-advice tasks are rejected.
  humanhitljudgementconsensusverifymoderationtranslationsubjectivecrowdsourceverdictconfidenceasync
• korea-disclosures
  Recent official disclosures of a Korean listed company from Korea DART. Give a ticker, corp code or name and get a structured feed of the issuer's filings with type, date, submitter and an English viewer link. Cited to the primary source.
  koreadartdisclosuresfilingsdue-diligencekospikosdaqopendartfsscross-bordernon-us
• korea-financials
  Normalized company financials from Korea DART filings. Give a ticker, corp code or name plus a year and get income statement, balance sheet and cash flow lines mapped to one clean schema with English labels, each value cited to its XBRL account id and filing. Compact cited JSON instead of raw Korean statements.
  koreadartfinancialsxbrlfundamentalsincome-statementbalance-sheetcash-flowdue-diligencekospikosdaqopendart
• korea-ratios
  Key financial ratios computed from Korea DART filings: margins, returns, liquidity, leverage and growth. Give a ticker, corp code or name plus a year and get ratios, each number citing the source accounts it was derived from, plus simple anomaly flags.
  koreadartratiosmarginsliquidityleveragegrowthfundamentalsdue-diligencekospikosdaqopendart
• provenance-verify
  Cryptographic C2PA / Content-Credentials verdict for a media file. Parses the embedded manifest, verifies the signature chain and asset hash-binding against the C2PA production + Interim trust lists, and returns a go/no-go verdict (authentic-provenance, untrusted-signer, tampered, unsigned) with the distilled signed claims. Cryptographic provenance, not a deepfake detector.
  c2paprovenancecontent-credentialsmediaauthenticityai-disclosureverdictagent
• provenance-inspect
  Raw C2PA manifest-store dump for a media file, with no verdict wrapper. Returns every manifest in the provenance chain with its claim generator, signer, assertion labels, edit actions, AI-source flag, ingredient graph and the granular validation codes. For agents that want the full provenance tree rather than a go/no-go verdict. Heavy binary fields (thumbnails, hash blobs) are not echoed.
  c2paprovenancecontent-credentialsmanifestinspectmediaagent
• cost-estimate
  Estimate the monthly cloud cost of an infrastructure-as-code config before you apply it: Terraform (plan JSON or HCL), CloudFormation or docker-compose. Returns total monthly USD, a per-resource breakdown (unit price, quantity, assumptions), FinOps policy findings and a budget verdict (pass, caution, block) against an optional monthly budget. AWS and Azure common resources. Cost estimate, not a bill.
  costfinopscloudawsazureterraformbudgetdevopsestimateagent
• cost-diff
  Estimate the monthly cost DELTA of an infrastructure change before you apply it: pass a Terraform plan (its resource changes) or a baseline and a proposed config and get total before, total after, the monthly delta, per-resource added / removed / modified line items, FinOps findings and a budget verdict (pass, caution, block). AWS and Azure common resources. Cost estimate, not a bill.
  costfinopscloudawsazureterraformdiffbudgetdevopsagent
• approvals-wallet
  Standing-state audit of a wallet's live ERC-20 token approvals. Indexes every approval the address ever granted, filters to those still live on-chain, flags unlimited, stale, scam-listed and canonical spenders, estimates money-at-risk, and returns a ranked revoke plan with ready calldata plus a 0-100 risk and allow, warn or block verdict. Risk indicators, not advice.
  securityapprovalallowancerevokewalleterc20draineronchainaudit
• approvals-nft
  Standing-state audit of a wallet's live NFT operator approvals. Indexes every ApprovalForAll the address granted, filters to operators still live on-chain via isApprovedForAll, flags scam-listed, stale and canonical operators, and returns a ranked revoke plan with ready setApprovalForAll calldata plus a 0-100 risk and allow, warn or block verdict. Risk indicators, not advice.
  securityapprovalnfterc721erc1155revokewalletdraineronchain
• attention-index
  Attention index for any word/entity fusing Wikipedia readership (Wikimedia pageviews, resolved word->article and disambiguated by real traffic) with the global news stream (GDELT coverage volume). Returns a 0-100 index, WoW/MoM deltas, datestamped spikes and a trend in one call. An attention/curiosity index over Wikipedia and world news — not Google Trends / Google search interest.
  attentiontrendswikipediapageviewsgdeltnewsinterestpopularitybuzzsignalresearchmonitoring
• attention-pageviews
  Wikipedia-readership attention index for a word/entity: resolves the word to an article (disambiguated by real traffic), then returns a 0-100 index, WoW/MoM deltas, a trend and datestamped spikes from daily pageviews. One pageviews call (+ resolution). A curiosity/readership index — not Google Trends.
  attentionwikipediapageviewstrendsinterestpopularityreadershipsignalresearchmonitoring
• pr-verdict
  One merge-safety verdict for a public GitHub pull request. Fetches the PR diff and runs it through code, secret, CI/CD pipeline and dependency scanners, returning a single verdict (pass, caution, block), a risk score and findings with severity, file, line and a fix hint. One call instead of slicing the diff into several. Security indicators, not a guarantee.
  githubpull-requestcode-reviewsecuritymergesupply-chainsecretscicdverdictagent

How to call

https://api.agentstools.dev

Listed in

Directories this entry was found in.