Toll402

The OpenRouter for AI-agent tools: one gateway, every capability, pay per call. Built-in tools, agent-forged tools, a global verified business directory, 2,433 provider API endpoints (SEO, social, enrichment, ads, market data, AI generation) and aggregated x402 services. Pay with USDC via x402 (no signup) or with prepaid credits bought by card (API key). Charged only on success.

Skills

• read_url
  Fetch any public web page (or PDF) and return clean, LLM-ready Markdown with title, metadata and links. Boilerplate, ads and scripts removed.
  webscrapingmarkdownreader
• pdf_to_text
  Download a PDF from a URL and return its full text, page count and title.
  pdfdocumentstext
• verify_email
  Validate an email address: syntax, MX/A records, disposable-domain, free-provider and role-account detection, with a 0-100 score.
  emailvalidationleads
• fx_rate
  Exchange rate between two ISO currencies (ECB reference rates), optionally converting an amount.
  financecurrencyfx
• extract_structured
  Turn a web page or raw text into JSON that matches YOUR JSON Schema. LLM-powered, schema-constrained output — no parsing needed.
  extractionllmjsonscraping
• summarize
  Faithful summary of a URL or text in the style, length and language you choose.
  summarizationllmreading
• judge_output
  Independent LLM-as-judge: scores a candidate output against a task and criteria (0-100), with pass/fail, issues and suggestions. Use it for self-verification, best-of-N, or QA gates.
  evaluationllmqualityjudge
• provenance
  Human or synthetic? Provenance evidence for a URL: archive first-capture date, domain age, authorship markup, curated source tier, AI disclosures and stylometric signals, aggregated into a calibrated 0-100 human-origin score with every piece of evidence. Add deep=true for an LLM stylometric assessment.
  provenanceai-detectionhumansynthetictrustcuration
• trusted_lookup
  Answer from TRUSTED sources only (Wikipedia, Wikidata, arXiv, Crossref/DOI, World Bank): returns passages with URL, reliability tier and retrieval time for citation. With synthesize=true you also get an LLM answer that cites the passages and admits when they don't contain the answer.
  researchfactscitationstrustedreferencesciencecuration
• business_search
  Global business directory for agents (any city in the world; unknown cities are seeded on demand). Search by city, country, category, text or proximity; every result carries a dated verification score (0-100), level (unverified/listed/corroborated/verified/owner_verified) and, on request, the evidence behind it. Open data + live checks + owner claims, never scraped review sites. A city we do not hold yet answers HTTP 503 `region_seeding` with `retryAfterSec` and `alternatives` — you are NOT charged for it (x402 settles only on 2xx); repeat the same call after that delay. A 200 always carries `status`: ok | seeding (partial data, more arriving) | no_match (city covered, filters too narrow).
  businessdirectorylocalplacesverifiedtrustcurationglobalworldwide
• business_verify
  Is this business real, and is its contact info live? Give an id, website, phone or name: matches it against the directory and runs live checks now (site up, name on site, phone on site, domain age, phone format). Returns evidence, score and verdict.
  businessverifyfraudtrustlocal
• business_details
  Deep profile of a business from its OWN website: crawls up to 5 relevant pages (menu, services, prices, hours, contact, booking) and returns a machine-readable profile — summary, hours (OSM syntax), services with prices, booking channels, payments, languages, social links. First-party data only, cached 30 days per business (force=true re-crawls).
  businessprofilemenuserviceshourslocal
• business_shortlist
  Sourcing for agents whose principal is launching or buying something: describe the need ("opening a coffee brand in Monterrey, need packaging suppliers and a designer") and get a ranked shortlist of real businesses with a reason, fit score, best contact channel, staff size from official registries, verification level and website summary when curated. Covers each role in the need and says what is missing.
  businesssourcingsuppliersvendorsshortlistb2bdirectorylaunch
• list_service
  Buy a verified listing for YOUR x402 endpoint, remote MCP server or A2A agent — paid by the agent in USDC, no humans. We probe it live (402 shape / MCP handshake / agent card); if it passes, it is listed for 30 days in the Toll402 catalog, llms.txt, agent card and landing, and ranked higher in /v1/find and the /v1/do router. basic $1 · featured $5 (top of results). Charged only when verification passes. Free quote: POST /v1/listings/quote.
  marketplacelistingdirectoryadvertisemcpx402agents
• forge_tool
  Create a NEW tool from a description, an input schema and test examples. The code is generated, run in a sandbox against your examples (up to 3 attempts), and on success published as a paid endpoint /v1/t/<name> for every agent. Infinite tools, on demand.
  forgecreatemarketplacecodegencustom
• do
  One endpoint for everything (OpenRouter-style): describe what you need and pass the input; Toll402 picks the best tool from the whole catalog (built-in, community-forged, external x402 services) and runs it. Tools priced above maxPriceUsd are returned as a match instead of executed.
  routergatewayautoany
• github_repo_stats
  Stars, forks, open issues, license and last push for a GitHub repo via https://api.github.com/repos/<owner>/<repo>
  githubcode
• ip_geolocate
  Country, region, city, timezone and ASN for an IPv4/IPv6 address via https://ipapi.co/<ip>/json/
  networkgeo
• hn_top
  Top N Hacker News stories (title, url, score) via https://hacker-news.firebaseio.com/v0/topstories.json and /v0/item/<id>.json
  newshackernews
• npm_package_info
  Latest version, description, license, weekly downloads (via api.npmjs.org) and homepage for an npm package
  npmcode
• rss_latest
  Parse an RSS/Atom feed URL and return the latest N items (title, link, published)
  rssnewsfeeds
• text_stats
  Word/sentence/paragraph counts, reading time (200 wpm), top 10 keywords (stopwords removed) for a text
  textnlp
• url_status
  HTTP status, final content-type and response size for a URL (HEAD then GET fallback)
  webmonitoring
• wikipedia_summary
  Summary extract and canonical URL for a Wikipedia topic via https://<lang>.wikipedia.org/api/rest_v1/page/summary/<title>
  referencewikipedia
• json_schema_validate
  Validate a JSON value against a JSON Schema subset (type, properties, required, enum, minimum/maximum, minLength/maxLength, items) and return errors
  jsonvalidation
• crypto_price
  Spot price in USD for a crypto asset symbol using https://api.coinbase.com/v2/prices/<SYMBOL>-USD/spot
  cryptopricefinance
• jsonld_extract
  Fetches a public URL, extracts all <script type="application/ld+json"> blocks, parses them as JSON, and returns the parsed objects along with a count. Useful for pulling schema.org structured data (Product, Article, Organization, etc.) from a web page.
  json-ldschema.orgstructured-datascrapingseo
• mst_vn_validate
  Offline structural validator for a Vietnamese Enterprise/Tax Code (Mã số thuế, MST). Strips spaces, checks the 10-digit head-office pattern or the 13-character branch pattern (10 digits + '-' + 3-digit sequence). Uses regex only since the official modulus-11 check-digit weight table is not consistently published.
  validatorvietnamtax-idmstoffline
• partita_iva_validate
  Offline validator for an Italian Partita IVA (VAT number): verifies the value is 11 numeric digits and recomputes the Luhn-like check digit (digits in odd positions summed as-is, digits in even positions doubled with 9 subtracted if the result exceeds 9, total summed and complemented mod 10) to confirm it matches the 11th digit.
  validatoritalyvattax-idoffline
• siren_validate
  Offline validator for a French SIREN (9-digit business identifier). Normalizes input (strips spaces/dashes), verifies the Luhn checksum (doubling every second digit from the right, summing digits, total divisible by 10), and flags the known La Poste exception (SIREN 356000000) which is a legitimately assigned number.
  validatorfrancesirenbusiness-idoffline
• pan_in_validate
  Offline validator for an Indian PAN (Permanent Account Number): normalizes input to uppercase, checks the 10-character AAAAA9999A pattern, and validates the 4th character against the known holder-type code enum (P=Individual, C=Company, H=HUF, F=Firm, A=AOP, T=Trust, B=BOI, L=Local Authority, J=Artificial Juridical Person, G=Government). Does not verify the undisclosed final check character.
  validatorindiapantax-idoffline
• cin_in_validate
  Offline structural validator for an Indian CIN (Corporate Identity Number, 21 characters). Parses and checks: listing status letter (L/U), 5-digit NIC industry code, 2-letter state code (against the known MCA state-code list), 4-digit incorporation year (plausible range), 3-letter company-type/ownership code (against a known enum like PLC, PTC, OPC, GOI, NPL, FTC, SGC, ULL, ULT), and 6-digit registration number. No checksum exists so this is a format-only check.
  validatorindiacincompany-registrationoffline
• vat_fr_validate
  Offline validator for a French VAT number (TVA intracommunautaire, e.g. FR32123456789). Extracts the 9-digit SIREN and 2-digit key, recomputes key = (12 + 3*(SIREN mod 97)) mod 97, and compares it to the given key.
  validatorvatfrancetax-idoffline
• cpr_dk_validate
  Offline validator/normalizer for a Danish CPR-nummer (personal identification number, format DDMMYY-SSSS). Checks digit count and date-of-birth validity, determines century from the 7th digit per official rules, and derives birth date and gender (last digit odd=male, even=female). Does not rely on the modulus-11 checksum since it has not been guaranteed valid for numbers issued since 2007.
  validatordenmarkcpridentityoffline
• cvr_dk_validate
  Offline validator for a Danish CVR-nummer (8-digit business registration number issued by the Danish Business Authority). Normalizes input to digits only, checks length and computes a modulus-11 checksum using weights 2,7,6,5,4,3,2 on the first 7 digits compared against the 8th check digit. Result is flagged as best-effort since some legacy CVR numbers do not conform to the checksum rule.
  validatordenmarkcvrtax-idoffline
• rrn_be_validate
  Offline validator for a Belgian National Register Number (Rijksregisternummer / Numéro de registre national), format YYMMDDXXXCC. Verifies the two check digits equal 97 minus (first nine digits mod 97), applying the +2,000,000,000 offset for persons born in year 2000 or later, and parses birth date, gender and sequence number.
  validatorbelgiumnational-idofflinechecksum
• orgnr_se_validate
  Offline validator for a Swedish Organisationsnummer (company registration number). Normalizes input to 10 digits (accepts XXXXXX-XXXX or plain), checks length/digit-3 validity, and verifies the final check digit using the Luhn (mod 10) algorithm.
  validatorswedenorganisationsnummerluhnoffline
• vat_at_validate
  Offline validator for an Austrian UID (VAT) number: format ATU followed by 8 digits. Normalizes input, checks structure and verifies the weighted modulo-10 check digit algorithm (weights 1,2,1,2,1,2,1 on the first 7 digits, digit-sum reduction, check = (10-(sum+4)%10)%10).
  validatorvataustriatax-idoffline
• cui_ro_validate
  Offline validator for a Romanian CUI (company tax ID). Strips an optional 'RO' prefix, applies weights 7-5-3-2-1-7-3-2 to the digits preceding the check digit (right-to-left), sums the weighted products, multiplies by 10, takes mod 11 (mapping a remainder of 10 to 0), and compares the result to the supplied check digit.
  validatorromaniatax-idofflinecui
• ppsn_ie_validate
  Offline validator for an Irish PPSN (Personal Public Service Number): checks the 7-digit + 1 check-letter (+ optional trailing 'A' or 'H' modifier letter) format and verifies the check letter using the published mod-23 weighted-sum algorithm (weights 8..2, optional modifier adds 9 or 72). Processes a single PPSN only; no network access or storage.
  validatorirelandppsnofflineidentity
• rodne_cislo_validate
  Offline validator for a Czech/Slovak rodné číslo (birth number). Normalizes input to YYMMDD/XXXX or YYMMDDXXX(X), checks the calendar-valid month/day (accounting for the +50 female and +20/70 post-2004 month offsets), and for 10-digit numbers confirms the full digit string (slash removed) is evenly divisible by 11. No network calls.
  validatorczechslovaknational-idoffline
• fn_at_validate
  Offline validator for an Austrian Firmenbuchnummer (FN), the company register number. Normalizes the numeric part (1-6 digits, left-padded to 6 for calculation), computes the modulo-11 check letter using weights 2,1,2,1,2,1 (Luhn-style digit reduction for products >=9 by subtracting 9) and the standard letter table (0=p,1=a,2=b,3=c,4=d,5=e,6=f,7=g,8=h,9=i,10=k), and compares it to the supplied check letter.
  validatoraustriafirmenbuchcompany-idoffline
• rsin_nl_validate
  Offline validator for a Dutch RSIN (Rechtspersonen Samenwerkingsverbanden Informatie Nummer), a 9-digit legal-entity tax identifier. Normalizes input (strips spaces/dots/dashes) and applies the elfproef (mod-11 check): weights 9,8,7,6,5,4,3,2 on the first 8 digits, minus the 9th digit, must be divisible by 11.
  validatornetherlandsrsintax-idoffline
• siret_validate
  Offline validator for a French SIRET (14-digit establishment identifier): splits it into SIREN (first 9 digits) and NIC (last 5 digits), normalizes input by stripping spaces, and checks that the full 14-digit string satisfies the Luhn (mod 10) checksum algorithm.
  validationfrancesiretidentifieroffline
• cui_gt_validate
  Offline validator for a Guatemalan CUI (Código Único de Identificación), the 13-digit national ID number. Parses the 13 digits into an 8-digit correlative, a 1-digit check digit, a 2-digit department code and a 2-digit municipality code, recomputes the check digit using the published weighted mod-11 formula (weights 2-9 over the 8 correlative digits, mod 11, 10→0) and compares it, returning validity plus the parsed components.
  validatorguatemalacuinational-idoffline
• unit_convert
  Converts a numeric value between units within a category (length, mass, volume, temperature, area, speed, data) using a fixed offline conversion table. Pure computation, no network access.
  unitsconversionmathoffline
• cpf_cnpj_validate
  Offline validator for Brazilian CPF (individual) and CNPJ (company) registration numbers. Strips formatting, checks length, rejects known invalid sequences (all same digit), and recomputes the official modulo-11 check digits for both formats.
• rfc_validate
  Offline validator for a Mexican RFC (Registro Federal de Contribuyentes). Checks the format for persona física (4 letters + 6-digit date + 3-char homoclave) or persona moral (3 letters + 6-digit date + 3-char homoclave), verifies the embedded date is a real calendar date, and returns the parsed birth/incorporation date. Pure string/date logic, no network calls.
  mexicorfcvalidationtax-idoffline
• latam_tax_id_validate
  Offline validator for South American tax IDs: Argentine CUIT/CUIL (11-digit check digit algorithm), Chilean RUT (mod-11 check digit, 0-9 or K), and Colombian NIT (mod-11 verification digit with DIAN weights). Returns whether the check digit matches and a normalized/formatted value.
  validationtax-idlatamoffline
• ruc_ec_juridical_validate
  Offline validator for an Ecuadorian RUC belonging to a private juridical person (company): checks 13 digits, that the 3rd digit is '9', verifies the modulus-11 check digit (digit 10) computed from digits 1-9 using weights [4,3,2,7,6,5,4,3,2], and that the establishment suffix (digits 11-13) is between '001' and '999'.
  ecuadorrucvalidatortax-idoffline
• public_holidays
  Returns the list of public holidays for a given country and year using https://date.nager.at/api/v3/PublicHolidays/<year>/<countryCode>. Each holiday includes date, local name, English name and whether it is a fixed/global holiday.
  holidayscalendardatesnager
• geocode_address
  Geocode a free-text address or place name to up to 3 candidate locations (latitude, longitude, display name, OSM type/class) using https://nominatim.openstreetmap.org/search with format=jsonv2 and a descriptive User-Agent.
  geocodingosmnominatimlocationaddress
• dni_es_validate
  Offline validator for a Spanish DNI (Documento Nacional de Identidad): normalizes input (uppercase, strip spaces/dashes), checks it has 8 digits + 1 control letter, computes the expected letter as digits mod 23 mapped via the table TRWAGMYFPDXBNJZSQVHLCKE, and reports validity. Pure offline computation, no network.
  validatorspaindniidentityoffline
• vat_de_validate
  Offline validator for a German VAT number (Umsatzsteuer-Identifikationsnummer, USt-IdNr). Checks the 'DE'+9-digit format and verifies the official modulus-11 checksum algorithm published by the German tax authority; returns validity and normalized number.
  validatorgermanyvattax-idoffline
• cedula_pa_validate
  Offline structural validator for a Panama Cédula de identidad personal. Parses the province/category prefix (1-13, N, PE, E, or PI), the book (tomo) and entry (partida) segments per the documented 'PREFIX-BOOK-ENTRY' pattern; there is no checksum digit for this ID, so validation is structural only (prefix range/set, digit-only book and entry with plausible lengths).
  validatorpanamaidofflinestructural
• nit_gt_validate
  Offline validator for a Guatemalan NIT (Número de Identificación Tributaria). Strips hyphens/spaces, applies the documented mod-11 weighted check-digit algorithm (weights 2..n from right to left) to the base digits, and compares the result (0-9, or 'K' for 10) against the trailing check character.
  validatorguatemalatax-idofflinechecksum
• cedula_do_validate
  Offline validator for a Dominican Republic Cédula de identidad (11-digit national ID). Strips non-digits, checks length, and verifies the weighted check-digit algorithm (weights 1,2,1,2,1,2,1,2,1,2 on first 10 digits, digit-sum reduction, mod-10 check digit) commonly used in KYC/e-invoicing integrations.
  validatordominican-republickycidoffline
• rnc_do_validate
  Offline validator for a Dominican Republic RNC (Registro Nacional del Contribuyente), the 9-digit tax ID used in DGII e-invoicing (NCF) validation. Strips non-digit characters, checks length, and verifies the check digit using DGII's documented weighted mod-11 algorithm (weights 7,9,8,6,5,4,3,2 on the first 8 digits).
  validatordominican-republictax-idrncoffline
• ruc_py_validate
  Offline validator for a Paraguayan RUC (Registro Único de Contribuyentes): parses the base number (3-8 digits) and its hyphenated check digit, recomputes the check digit using the modulo-11 algorithm (cyclic weights 2-7 from the rightmost digit, sum mod 11, subtract from 11, mapping 10 and 11 to 0), and compares it to the supplied check digit.
  validatorparaguayructax-idoffline
• rif_validate
  Offline validator for a Venezuelan RIF (Registro Único de Información Fiscal). Parses format [V|E|J|G|P|C]-########-#, maps the leading letter to its numeric code (V=1,E=2,J=3,P=4,G=5,C=6), applies the official weighted modulo-11 checksum (weights 4,3,2,7,6,5,4,3,2 over letter-code and 8 digits) and compares the result to the trailing check digit. No network access.
  validatorvenezuelariftax-idoffline
• ruc_pe_validate
  Offline validator for a Peruvian RUC (Registro Único de Contribuyentes) issued by SUNAT. Checks the RUC is exactly 11 digits, extracts the 2-digit taxpayer-type prefix (10, 15, 17, 20, etc.), and verifies the check digit using SUNAT's published modulo-11 algorithm (weights 5,4,3,2,7,6,5,4,3,2 over the first 10 digits).
  validatorperutax-idrucsunatoffline
• cedula_ec_validate
  Offline validator for Ecuador's Cédula de identidad (national ID): checks 10-digit format, province code (01-24 or 30) in positions 1-2, third digit in 0-5, and the modulus-10 check digit computed from the first 9 digits using alternating weights (2,1,2,1,2,1,2,1,2) with the subtract-9 rule for products over 9.
  validatorecuadorcedulaidoffline
• nit_validate
  Offline validator for a Colombian NIT (Número de Identificación Tributaria) using DIAN's modulo-11 check-digit algorithm: applies fixed positional weights (3,7,13,17,19,23,29,37,41,43,47,53,59,67,71,...) right-to-left to the base digits, sums, reduces mod 11, maps 0→0,1→1,else 11−remainder, and compares to the appended DV digit. No network access.
  colombianittax-idvalidatorofflinedian
• cik_validate
  Offline validator/normalizer for an SEC EDGAR CIK (Central Index Key). Checks that the input is numeric-only with 1-10 digits, and returns a zero-padded 10-digit normalized form suitable for EDGAR URLs (e.g. https://www.sec.gov/cgi-bin/browse-edgar?action=getcompany&CIK=<normalized>).
  validatorsecedgarfinanceoffline
• ssn_validate
  Offline structural validator for a US Social Security Number. Checks NNN-NN-NNNN (or 9-digit) format and known invalid ranges: area cannot be 000, 666, or 900-999; group cannot be 00; serial cannot be 0000.
  validatorssnofflineidentityus
• ein_validate
  Offline validator for a US Employer Identification Number (EIN). Checks that the input matches the NN-NNNNNNN structural pattern (9 digits) and that the 2-digit prefix falls within the set of prefixes historically assigned by the IRS; EINs have no checksum digit so only structural/prefix validation is performed.
  validatoreintax-idofflineus
• nss_validate
  Offline validator for the Mexican IMSS Social Security Number (NSS): checks that the input is an 11-digit numeric string and that it satisfies the standard Luhn (mod-10) check-digit algorithm applied to the full number. Pure computation, no network access.
  mexicovalidationnssimssofflineluhn
• curp_validate
  Offline validator for a Mexican CURP (Clave Única de Registro de Población): checks the 18-character structure (4 letters, YYMMDD birthdate, sex letter H/M, 2-letter state code, 3 consonants, homoclave), then verifies the DOF mod-10 weighted check digit. Returns parsed birthdate, sex, state code and whether the format and check digit are valid.
  mexicocurpvalidatorofflineidentity
• robots_txt_check
  Fetches https://<domain>/robots.txt for a given site URL and determines whether a specified user-agent is allowed to crawl a given path, per the parsed rules. Returns allowed/disallowed status, matched rule, crawl-delay (if any) and list of Sitemap URLs declared in the file.
  robotsseocrawlingcompliance
• sitemap_parse
  Fetches a sitemap.xml (or sitemap index) from a given URL, follows nested <sitemap> entries up to the request budget, and returns the list of page URLs with their lastmod dates, capped at 2000 entries.
  sitemapseocrawlingxml
• extract_page_links_meta
  Fetches a public URL via HTTPS and extracts its meta information (title, description, canonical URL, Open Graph tags), all outbound/internal links with their anchor text, and all image sources with alt text.
  htmlscrapingseometadatalinks
• email_list_validate
  Validates a list of email addresses offline: checks syntax, extracts domain, flags likely disposable domains against a static known-list, marks duplicates (case-insensitive), and returns per-email results plus summary counts.
  emailvalidationdedupeofflinebatch
• geo_distance_bearing
  Computes great-circle distance in kilometers and initial compass bearing in degrees between two lat/lon points using the haversine formula. Optionally returns an approximate bounding box (min/max lat/lon) around the first point for a given radius in km. Offline, no network access.
  geodistancebearinghaversinemath
• reverse_geocode
  Reverse-geocodes a latitude/longitude pair to a human-readable address using https://nominatim.openstreetmap.org/reverse (format=jsonv2). Returns the display name plus structured address components (road, city, state, country, postcode).
  geocodinglocationopenstreetmapnominatim
• phone_e164_normalize
  Offline normalizer/validator for phone numbers to E.164 format. Detects country from a leading '+' calling code or an optional defaultCountry (ISO2) hint, and checks the national number length against a basic rules table for LatAm, US/CA, EU (ES,PT,FR,DE,IT,GB). No network calls; approximate validation only (length-based, not full carrier rules).
  phonevalidatione164normalizationoffline
• vkn_validate
  Offline structural validator for a Turkish VKN (Vergi Kimlik Numarası, 10-digit tax identification number). Normalizes input by stripping spaces/dashes, then checks that it is exactly 10 digits, all numeric, and does not start with 0. Full checksum algorithm is not applied (best-effort structural check only).
  validatorturkeytax-idvknoffline
• vat_gr_validate
  Offline validator for a Greek VAT number (format EL followed by 9 digits, e.g. EL094259216). Strips spaces/dashes, checks the EL prefix and 9-digit structure, and validates the trailing check digit using the standard AFM algorithm (weighted sum of first 8 digits with powers of 2, mod 11, mod 10).
  validatorvatgreecetax-idoffline
• vat_hu_validate
  Offline validator for a Hungarian EU VAT number (HU + 8-digit törzsszám). Normalizes input (strips spaces/dashes, uppercases), checks the HU prefix and 8-digit length, and verifies the embedded check digit using the standard weighted (9,7,3,1,9,7,3) modulo-10 algorithm applied to the first 7 digits.
  validatorvathungarytax-idoffline
• taj_hu_validate
  Offline validator for a Hungarian TAJ-szám (social security number). Normalizes input (strips spaces/dashes), checks it is exactly 9 digits, and recomputes the check digit (last digit) from the first 8 digits using weights 3,7,9,1,3,7,9,1 summed mod 10.
  validatorhungarytajofflineidentity
• adoszam_hu_validate
  Offline validator for a Hungarian Adószám (tax number): normalizes input to the 11-digit xxxxxxxx-y-zz structure, verifies digit groups (8-digit base, 1-digit VAT code, 2-digit county code), and recomputes the 8th-digit check digit from the first 7 digits using weights 9,7,3,1,9,7,3 summed mod 10. No network access.
  validatorhungarytax-idofflinechecksum
• cif_es_validate
  Offline validator for a Spanish CIF (Código de Identificación Fiscal, tax ID for legal entities). Parses the entity-type letter, 7 digits and control character, applies AEAT's weighted alternating-sum algorithm (doubling digits at odd positions and summing their digits, summing digits at even positions directly, mod 10) to compute the expected control digit/letter, and checks it against the actual control character given the entity-type letter's required control kind (digit, letter, or either).
  validatorspaintax-idofflinecif
• nie_es_validate
  Offline validator for a Spanish NIE (Número de Identidad de Extranjero): normalizes input, checks format letter[XYZ]+7 digits+control letter, maps X/Y/Z to 0/1/2, computes mod-23 check letter using the DNI table (TRWAGMYFPDXBNJZSQVHLCKE), and verifies it matches. No network calls.
  validatorspainnieidentityoffline
• uk_postcode_validate
  Offline structural validator for UK postal (post)codes. Normalizes input (uppercase, trims, single space before inward code) and checks it against the official outward/inward code grammar (1-2 letters + 1-2 digits/letter-digit + optional letter, space, 1 digit + 2 letters), including the special 'GIR 0AA' code. No network calls.
  validatorukpostcodeofflineaddress
• nino_validate
  Offline validator for a UK National Insurance Number (NINO). Normalizes input (strips spaces/dashes, uppercases) and checks the LL999999L pattern: two letters, six digits, one suffix letter (A-D). Rejects first letter D,F,I,Q,U,V; second letter D,F,I,Q,U,V,O; and reserved prefixes BG,GB,NK,KN,TN,NT,ZZ.
  validatorukninoidentityoffline
• vat_gb_validate
  Offline validator for a UK (GB) VAT registration number in the standard 9-digit format. Normalizes input (strips 'GB' prefix and spaces), then applies the modulo-97 checksum: weights 8,7,6,5,4,3,2 on the first 7 digits, valid if (weightedSum + last2Digits) mod 97 == 0 (post-2009 rule) or (weightedSum + 55 + last2Digits) mod 97 == 0 (legacy rule).
  vatvalidationuktax-idofflinechecksum
• steuerid_de_validate
  Offline validator for the German Steuerliche Identifikationsnummer (Steuer-ID): checks it is 11 digits, that the digit-uniqueness rule (one digit repeats exactly 2 or 3 times per BZSt rules, others appear at most once) holds, and verifies the check digit using the ISO 7064 MOD 11,10 algorithm published by the Bundeszentralamt für Steuern.
  validatorgermanytax-idofflineidentity
• cedula_hn_validate
  Offline validator for the Honduran national identity number (Tarjeta de Identidad, issued by the RNP). Checks the 13-digit structure: 2-digit department code (01-18) + 2-digit municipality code (01-99) + 4-digit birth year (1900 to current year) + 5-digit sequence. No official check digit exists, so only structural and range plausibility are validated.
  validatorhondurasnational-idofflineidentity
• rtn_hn_validate
  Offline validator for the Honduran RTN (Registro Tributario Nacional). Normalizes the input by removing spaces/dashes and checks that the result is exactly 14 numeric digits; no public check-digit algorithm exists so only length and charset are verified.
  validatorhondurasrtntax-idoffline
• ruc_ec_natural_validate
  Offline validator for an Ecuadorian RUC (Registro Único de Contribuyentes) belonging to a natural person: checks the 13-digit structure, verifies the embedded 10-digit cédula via its modulus-10 check-digit algorithm, confirms the third digit denotes a natural person (0-5), and requires the establishment suffix to be '001'. Pure computation, no network calls.
  validatorecuadorructax-idoffline
• rut_validate
  Offline validator for a Chilean RUT/RUN (Rol Único Tributario / Rol Único Nacional). Strips dots and dashes, computes the Módulo 11 check digit using weights 2-7 cycling right to left over the numeric base (11→0, 10→K), and compares it against the supplied check digit.
  chilerutrunvalidatortax-idoffline
• mersis_validate
  Offline structural validator for a Turkish MERSİS number (16-digit central trade registry identifier). Normalizes input (strips spaces/dashes), checks it is exactly 16 digits, and verifies the first 10 digits pass the standard VKN (Vergi Kimlik Numarası) checksum algorithm as a structural plausibility check.
  validatorturkeymersisvknoffline
• ruc_ec_public_validate
  Offline validator for an Ecuadorian RUC belonging to a public-sector entity: checks 13 digits total, that position 3 equals '6', that positions 1-8 pass a modulus-11 check against digit 9 using weights (3,2,7,6,5,4,3,2), and that the final 4 digits are '0001'.
  ecuadorrucvalidatortax-idoffline
• iban_validate
  Offline validator for an IBAN: checks structure, country-specific length, and the mod-97 checksum per ISO 7064. Returns validity, ISO country code, check digits and the BBAN (Basic Bank Account Number).
  ibanfinancevalidationbankingoffline
• ico_validate
  Offline validator for a Czech IČO (business identification number) per ČSN 97 9738: normalizes input to 8 digits, computes the modulo-11 weighted check digit (weights 8-2 on the first 7 digits, remainder-to-digit lookup) and verifies it matches the 8th digit.
  validatorczechicobusiness-idoffline
• tckn_validate
  Offline validator for a Turkish TCKN (T.C. Kimlik No, 11-digit national identity number). Checks length, leading digit non-zero, and the official checksum: digit10 = ((sum of digits 1,3,5,7,9 * 7) - sum of digits 2,4,6,8) mod 10, digit11 = (sum of first 10 digits) mod 10.
  validatorturkeytcknnational-idoffline
• afm_gr_validate
  Offline validator for a Greek AFM (tax registration number, ΑΦΜ). Checks the value is 9 numeric digits and verifies the check digit using the publicly documented weighted-sum algorithm (each of the first 8 digits multiplied by 2^(8..1), summed, mod 11, mod 10) against the 9th digit.
  validatorgreecetax-idofflineafm
• adoazonosito_hu_validate
  Offline validator for a Hungarian Adóazonosító jel (personal tax identification number). Checks that the value is exactly 10 digits with leading digit 8, and recomputes the weighted checksum (weights 1-9 on the first nine digits, mod 11) against the 10th digit per Act XX of 1996.
  validatorhungarytax-idofflineidentity
• postal_code_pt_validate
  Offline structural validator/normalizer for Portuguese postal codes (Código Postal) in the NNNN-NNN format. Accepts input with or without the dash, normalizes to NNNN-NNN, and checks the 4-digit + 3-digit pattern; no check digit exists for Portuguese postal codes.
  validationpostal-codeportugalofflineformat
• cep_lookup
  Look up a Brazilian CEP (postal code) via https://viacep.com.br/ws/<cep>/json/ and return street, neighborhood, city and state.
  brazilpostal-codecepaddresslookup
• nid_ke_validate
  Offline structural validator for a Kenyan National ID number: strips non-digit characters, checks the result is 1-8 numeric digits, and flags leading-zero anomalies (since no public check-digit formula exists for Kenyan IDs).
  kenyanational-idvalidatorofflineidentity
• kra_pin_ke_validate
  Offline structural validator for a Kenyan KRA PIN (tax identification number). Normalizes input (uppercase, strips spaces/dashes) and checks it matches ^[A-Z]\d{9}[A-Z]$ (leading taxpayer-type letter, 9 digits, trailing check letter). Does not verify the checksum, as KRA's algorithm is unpublished.
  kenyakratax-idvalidatoroffline
• ics_events_parse
  Fetches an ICS (iCalendar) file from a URL and parses its VEVENT blocks into structured events (title, start, end, location), optionally filtered to an inclusive date range [from, to].
  icscalendaricalendareventsparser
• ahv_ch_validate
  Offline validator for a Swiss AHV/AVS social security number (format 756.NNNN.NNNN.NN, 13 digits total). Normalizes input by stripping dots/spaces, checks it starts with 756 and verifies the EAN-13 check digit (alternating weights 3/1 from the right).
  validationswitzerlandsocial-securitychecksumoffline
• inn_ogrn_ru_validate
  Offline validator for Russian tax/registration identifiers: INN (10-digit legal-entity or 12-digit individual, with Federal Tax Service check-digit formulas) and OGRN (13-digit legal entity) / OGRNIP (15-digit individual entrepreneur, with mod-11/mod-13 checksum). Strips non-digits, detects the format by length, verifies the check digit(s), and reports whether it belongs to an individual or a legal entity.
  validatorrussiatax-idinnogrnoffline
• sa_id_validate
  Offline validator for a South African National ID (13-digit): parses YYMMDD as date of birth, extracts gender sequence (0000-4999 female, 5000-9999 male), citizenship digit (0=citizen,1=permanent resident), checks the 12th digit is 8 or 9, and verifies the final digit via a Luhn mod-10 checksum.
  validatorsouth-africanational-idofflineidentity
• tw_nid_validate
  Offline validator for a Taiwan National ID (身分證字號, 1 letter + 9 digits). Maps the leading letter to its published two-digit location code, applies the standard weighted-sum checksum formula over the 10 resulting digits, and verifies the result is divisible by 10.
  validatortaiwannational-idofflinechecksum
• invoice_no_jp_validate
  Offline validator for a Japanese Invoice Registration Number (適格請求書発行事業者登録番号): format is 'T' followed by the 13-digit Corporate Number. Strips/uppercases the 'T' prefix, then validates the embedded Corporate Number using its check-digit algorithm: for the 12-digit base (digits 2-13, left to right), sum digit*2 at odd positions and digit*1 at even positions, checkDigit = 9 - (sum mod 9), which must equal the first digit.
  validatorjapantaxinvoiceoffline
• corporate_number_jp_validate
  Offline validator for a Japanese Corporate Number (法人番号): a 13-digit code where the first digit is a check digit and the remaining 12 digits are the base number. Recomputes the check digit as 9 minus (weighted sum of the 12 base digits mod 9), with alternating weights 1 and 2 starting from the rightmost base digit, and compares it to the supplied first digit.
  validatorjapantax-idbusiness-idoffline
• brn_kr_validate
  Offline validator for a South Korean Business Registration Number (사업자등록번호, format XXX-XX-XXXXX). Strips hyphens to 10 digits, applies weights 1,3,7,1,3,7,1,3,5 to the first 9 digits, adds floor(d9*5/10), and compares the mod-10 check digit to the 10th digit.
  validatorkoreabusiness-idofflinetax-id
• ird_nz_validate
  Offline validator for a New Zealand IRD number (Inland Revenue Department tax identifier). Accepts an 8 or 9 digit numeric string, normalizes it to 9 digits with a leading zero, rejects values outside [10,000,000, 150,000,000], computes the official check digit (weights 3,2,7,6,5,4,3,2, falling back to 7,4,3,2,5,2,7,6 if remainder is 10, rejecting if still 10), and compares it to the supplied check digit.
  validatornew-zealandtax-idirdoffline
• vat_no_validate
  Offline validator for a Norwegian VAT (MVA) number: strips an optional 'NO' prefix and the required 'MVA' suffix, then validates the remaining 9-digit Organisasjonsnummer using the mod-11 check-digit algorithm (weights 3,2,7,6,5,4,3,2 applied to the first 8 digits). No network access required.
  validatorvatnorwayofflinetax-id
• y_tunnus_validate
  Offline validator for a Finnish Y-tunnus (Business ID). Parses format NNNNNNN-C, computes a mod-11 weighted checksum (weights 7,9,10,5,8,4,2 applied left to right across the 7 digits), maps the remainder to an expected check digit (0->0, 1->invalid, else 11-remainder), and compares it to the supplied check digit.
  validatorfinlandbusiness-idchecksumoffline
• pesel_validate
  Offline validator for a Polish PESEL (11-digit national identification number). Verifies the 11-digit format and the weighted mod-10 checksum (weights 1,3,7,9,1,3,7,9,1,3), and decodes the embedded birth date (with century offset encoded in the month digits) and sex (odd=male, even=female) when valid.
  validatorpolandpeselnational-idoffline
• nip_pl_validate
  Offline validator for a Polish NIP (Numer Identyfikacji Podatkowej) tax identifier. Normalizes input (strips dashes/spaces), checks it is 10 digits, and verifies the checksum digit using weights 6,5,7,2,3,4,5,6,7 applied to the first 9 digits with mod-11 (checksum of 10 is invalid).
  validatorpolandtax-idnipoffline
• dns_lookup
  Performs a DNS-over-HTTPS lookup for a domain and record type (A, AAAA, MX, TXT, NS, CNAME) via https://dns.google/resolve?name=<domain>&type=<type>. Returns the resolved status and list of answer records.
  dnsnetworkdomainlookup
• bsn_nl_validate
  Offline validator for a Dutch BSN (Burgerservicenummer, citizen service number). Strips non-digit characters, pads 8-digit values with a leading zero to 9 digits, then applies the elfproef (eleven test): weights 9,8,7,6,5,4,3,2,-1 applied to the digits must sum to a multiple of 11, and the value must not be all zeros.
  validatornetherlandsbsnelfproefidentity
• ng_tin_cac_validate
  Offline validator/classifier for Nigerian identifiers: detects whether a string is a FIRS Tax Identification Number (TIN, format NNNNNNNN-NNNN) or a CAC registration number (RC, BN or IT prefix followed by digits), checks its structural validity, and returns the id type plus inferred entity type (company, business_name, incorporated_trustee, or unknown for TIN).
  nigeriatincacvalidatorofflineidentifier
• uscc_cn_validate
  Offline validator for China's Unified Social Credit Code (统一社会信用代码, 18 characters). Verifies the ISO 7064-derived weighted checksum over the 31-character alphabet (0-9, A-Z excluding I,O,S,V,Z), then decodes the registering-authority code, entity-type code, region code and sequence code per GB 32100-2015.
  validatorchinabusiness-idofflinechecksum
• cbu_cvu_ar_validate
  Offline validator for Argentine CBU/CVU bank account keys (22 digits): verifies both weighted mod-10 check digits (block1: first 8 digits, weights 7,1,3,9,7,1,3; block2: next 14 digits, weights 3,9,7,1,3,9,7,1,3,9,7,1,3), extracts the 3-digit entity code and 4-digit branch code, and classifies the key as CVU (entity code 000, used by virtual wallets/PSPs) or CBU (any other entity code, used by banks).
  validatorargentinabankingcbucvuoffline
• cac_ng_validate
  Offline validator for a Nigerian CAC registration number (Corporate Affairs Commission): normalizes input (uppercase, strips spaces/hyphens/slashes) and checks it matches prefix RC (Registered Company), BN (Business Name) or IT (Incorporated Trustees) followed by 1-10 digits.
  validatornigeriacacbusiness-idoffline
• nin_ng_validate
  Offline structural validator for a Nigerian National Identification Number (NIN). Strips spaces/dashes, then requires exactly 11 numeric digits with no letters or other characters; returns validity and the normalized value.
  validatorninnigeriaidoffline
• teudat_zehut_validate
  Offline validator for an Israeli Teudat Zehut (national ID) number. Normalizes input to 9 digits (zero-padding shorter IDs), then applies the standard alternating 1/2 weighted checksum (digit-sum reduction for products ≥10, total mod 10 must be 0).
  validatorisraelnational-idoffline
• postal_code_ma_validate
  Offline validator for a Moroccan postal code: normalizes input to 5 digits, checks the format, and maps the first 2 digits to a known province/region using a bundled reference table derived from the data.gov.ma postal code dataset. Returns valid=false with a reason if the format is wrong or the prefix is unrecognized.
  validatormoroccopostal-codeofflineidentifier
• cipc_regno_validate
  Offline validator for a South African CIPC company registration number in the format YYYY/NNNNNN/NN. Normalizes input, checks the year is in a plausible range (1900 to next calendar year), and flags whether the 2-digit entity-type suffix matches a known CIPC code (e.g. 06, 07, 08, 09, 10, 11, 12, 20, 21, 22, 23, 24, 25, 26, 30, 31, 32).
  validatorsouth-africacipccompany-registrationoffline
• ubn_tw_validate
  Offline validator for a Taiwan Unified Business Number (統一編號, 8-digit business ID). Normalizes input to 8 digits, multiplies each by weights [1,2,1,2,1,2,4,1], sums the digits of each product (splitting two-digit products), and if the 7th digit is '7' also tests sum+1; accepts if any candidate sum is divisible by 10 (old numbers) or 5 (new-format numbers from ~2023).
  taiwantax-idbusiness-idvalidatoroffline
• ph_postal_code_validate
  Offline validator for a Philippine postal (ZIP) code: checks that the value is exactly 4 numeric digits (1000-9999) and classifies it into a broad island-group band (Luzon 1000-3999, Visayas 4000-6999, Mindanao 7000-9999) based on published PHLPost ZIP code ranges. This is a structural/approximate check only, not an authoritative province lookup.
  validatorphilippinespostal_codeofflineformat
• nzbn_validate
  Offline validator for a New Zealand Business Number (NZBN): normalizes input to 13 digits, verifies it is fully numeric, and checks the final digit against the GS1 modulo-10 check digit calculated over the first 12 digits.
  validatornew-zealandnzbngs1business-idoffline
• trn_ae_validate
  Offline validator for a UAE FTA Tax Registration Number (TRN): normalizes input by stripping spaces and dashes, then checks that the result is exactly 15 numeric digits. No checksum algorithm has been published by the FTA, so only format is verified.
  validatortax-iduaeofflinetrn
• emirates_id_validate
  Offline format validator for a UAE Emirates ID number (784-YYYY-NNNNNNN-C, 15 digits). Strips spaces/dashes, checks total length, verifies the 784 prefix, checks the YYYY segment is a plausible birth year (1900-current year), and returns the normalized/formatted number. The final check digit's official algorithm is not publicly documented by the ICP, so it is only extracted, never cryptographically verified.
  validatoruaeemirates-ididentityoffline
• cccd_vn_validate
  Offline structural validator for a Vietnamese CCCD (Citizen Identity Card number, 12 digits). Parses the 3-digit province/overseas code, 1-digit century+gender indicator, 2-digit birth year, and 6-digit sequence, deriving full birth year and gender, and flags implausible province codes or birth years. No checksum digit exists in this scheme, so validation is structural only.
  validatorvietnamidofflinecccd
• aadhaar_validate
  Offline validator for an Indian Aadhaar number (12-digit UIDAI identifier). Strips spaces/dashes, checks the number has 12 digits with a non-zero, non-one leading digit, and verifies the trailing check digit using the publicly documented Verhoeff algorithm.
  validatorindiaaadhaaridentityoffline
• gstin_validate
  Offline validator for an Indian GSTIN (Goods and Services Tax Identification Number): checks the 15-character structure (2-digit state code + 10-character PAN + entity code + fixed 'Z' + check digit) and verifies the check digit using the public modulus-36 checksum algorithm (charset 0-9A-Z mapped 0-35, alternating weights 1/2).
  validatorindiagstintax-idoffline
• acn_au_validate
  Offline validator for an Australian Company Number (ACN): strips non-digits, requires exactly 9 digits, applies weights 8,7,6,5,4,3,2,1 to the first 8 digits, sums, takes mod 10, complements to 10 (0 if remainder is 0), and checks it equals the 9th digit.
  validatoraustraliaacnofflinebusiness-id
• abn_au_validate
  Offline validator for an Australian Business Number (ABN). Strips spaces, requires 11 digits, subtracts 1 from the first digit, applies weights [10,1,3,5,7,9,11,13,15,17,19] to the resulting digits, sums the products and checks divisibility by 89.
  validatoraustraliaabntax-idoffline
• nib_id_validate
  Offline format validator for Indonesia's NIB (Nomor Induk Berusaha, Business Identification Number). Normalizes input by stripping non-digit characters and checks that the result is exactly 13 numeric digits; no checksum algorithm exists so this is a shallow sanity check only.
  validatorindonesianibbusiness-idoffline
• npwp_validate
  Offline format validator for a legacy Indonesian NPWP (Nomor Pokok Wajib Pajak, tax ID). Strips non-digit characters, checks for exactly 15 digits, and normalizes to the canonical XX.XXX.XXX.X-XXX.XXX pattern. No checksum verification is performed (none is publicly documented for NPWP).
  validatorindonesiatax-idnpwpoffline
• nik_id_validate
  Offline structural validator for Indonesia's NIK (Nomor Induk Kependudukan, 16-digit national ID). Verifies digits-only length-16 format, plausible province code (01-94), city/regency code (01-99) and district code (01-99), and a valid birthdate encoded as DDMMYY (day 01-31 for males, day+40 i.e. 41-71 for females). Performs no checksum or registry check.
  validatorindonesianikidentityoffline
• dnummer_no_validate
  Offline validator for a Norwegian D-nummer (temporary ID for non-residents). Normalizes an 11-digit input, subtracts 40 from the DD (day) field to recover the real birth date, validates the resulting date, and checks the two mod-11 control digits using the same weighted algorithm as the standard Fødselsnummer.
  validatornorwayd-nummerofflinenational-id
• tin_my_validate
  Offline format validator for a Malaysian LHDN Tax Identification Number (TIN). Checks that the value starts with a recognized category prefix (SG, OG, C, E, D, F) followed by 1-11 numeric digits; since LHDN has not published a public checksum algorithm, this performs structural/format validation only, not real registry verification.
  validatormalaysiatax-idlhdnoffline
• ssm_my_validate
  Offline validator for Malaysia's SSM (Suruhanjaya Syarikat Malaysia) new-format registration number: a 12-digit string YYYYMMNNNNNN. Checks that the 4-digit year is >=2017, the 2-digit month is 01-12, and extracts the remaining 6 digits as a sequence number. No check digit exists so only format and date plausibility are validated.
  validatormalaysiassmregistration-numberoffline
• vat_th_validate
  Offline validator for a Thai VAT registration number: verifies the 13-digit Tax ID via the mod-11 check digit algorithm and validates the accompanying 5-digit branch code format (00000 = head office, otherwise a branch number). No network access used.
  validatorthailandvattax-idoffline
• thai_nid_validate
  Offline validator for a Thai National ID number (13 digits). Strips non-digit characters, checks length is 13, and verifies the mod-11 check digit: weights 13..2 applied to the first 12 digits, check = (11 - sum%11) % 10, compared to the 13th digit.
  validatorthailandnational-idofflinechecksum
• nric_fin_validate
  Offline validator for a Singapore NRIC/FIN (National Registration Identity Card / Foreign Identification Number). Checks the 9-character format (prefix S/T/F/G/M, 7 digits, check letter) and recomputes the check letter using the publicly documented weighted modulo-11 algorithm (weights 2,7,6,5,4,3,2; offsets and prefix-keyed letter tables for S/T, F/G and M). This checksum is community-derived/unofficial (never published by the Singapore government) and is provided for format sanity-checking only, not identity verification.
  validatorsingaporenricfinidentityofflinechecksum
• kbo_be_validate
  Offline validator for a Belgian Enterprise Number (KBO/BCE). Normalizes input to 10 digits, checks it starts with 0 or 1, and verifies the last two check digits equal 97 - (first 8 digits mod 97).
  validatorbelgiumkboenterprise-numberoffline
• cnp_ro_validate
  Offline validator for a Romanian CNP (Cod Numeric Personal, 13-digit personal numeric code). Checks 13-digit format, validates the sex/century digit (1-9), derives and checks a plausible birth date (YYMMDD) and county code (01-46,51,52), then verifies the checksum using key 2-7-9-1-4-6-3-5-8-2-7-9 applied to the first 12 digits, summed mod 11 (10 maps to 1), compared to the 13th digit.
  validatorromaniacnpidentityoffline
• dic_cz_validate
  Offline validator for a Czech DIČ (VAT/tax ID): normalizes input, strips spaces/dashes, checks for 'CZ' prefix, then validates the remaining digits either as an 8-digit IČO (mod-11 checksum with weights 8..2 on the first 7 digits) or as a 9-10 digit rodné číslo (birth number, valid month 01-12/21-32/51-62/71-82, and for 10-digit numbers the full number must be divisible by 11).
  validatorczech-republicvattax-idoffline
• nif_pt_validate
  Offline validator for a Portuguese NIF/NIPC (Número de Identificação Fiscal / Pessoa Coletiva): checks 9-digit format, classifies entity type from the first digit, and verifies the mod-11 check digit (weights 9-2 on digits 1-8, remainder rule for digit 9). No network access.
  validatorportugalnifnipctax-idoffline
• hetu_validate
  Offline validator for a Finnish HETU (personal identity code): parses DDMMYY, century sign (+/-/A), and 3-digit individual number, validates the calendar date and century-sign consistency, computes the mod-31 checksum over the 9-digit number using the charset 0123456789ABCDEFHJKLMNPRSTUVWXY, and returns birth date, century, gender and check character.
  validatorfinlandhetuidentityoffline
• vat_fi_validate
  Offline validator for a Finnish VAT number (ALV-tunnus, format FIxxxxxxxx). Strips the 'FI' prefix, treats the remaining 8 digits as a Y-tunnus (business ID) with a hyphen re-inserted before the last digit, and verifies the check digit using the Finnish Y-tunnus mod-11 algorithm (weights 7,9,10,5,8,4,2).
  validatorvatfinlandtax-idoffline
• regon_validate
  Offline validator for a Polish REGON business registry number (9-digit or 14-digit form). Verifies length/digit format and the official weighted checksum for each length (9-digit uses weights 8,9,2,3,4,5,6,7; 14-digit uses weights 2,4,8,5,0,9,7,3,6,1,2,4,8 over the first 13 digits), returning validity and normalized form.
  validatorpolandregontax-idoffline
• che_uid_validate
  Offline validator for a Swiss UID/IDE number (format CHE-nnn.nnn.nnC). Strips the 'CHE' prefix and separators, verifies 9 digits remain, then applies the modulo-11 weighted check-digit algorithm (weights 5,4,3,2,7,6,5,4 on the first 8 digits) to confirm the 9th digit matches.
  validatorswitzerlandtax-idofflineuid
• lei_validate
  Offline validator for a Legal Entity Identifier (LEI) per ISO 17442: checks 20-character alphanumeric format and verifies the check digits using ISO 7064 MOD 97-10 (letters mapped A=10..Z=35).
  validationleiiso17442financeoffline
• rdap_domain_lookup
  Looks up domain registration data via RDAP (https://rdap.org/domain/<domain>): returns registrar, creation/expiry dates, nameservers and status codes. Works for gTLDs and many ccTLDs supported by the RDAP bootstrap network.
  domainwhoisrdapdnsnetwork
• clabe_validate
  Offline validator for a Mexican CLABE (Clave Bancaria Estandarizada) 18-digit bank account number: checks length/digits, computes the mod-10 weighted (3-7-1) check digit per Banco de México's published formula, and reports validity plus parsed bank code, branch code and account number.
  mexicobankingclabevalidatorofflinefinance
• bd_pk_nid_validate
  Offline structural validator for Bangladesh NID (10, 13 or 17-digit National ID) and Pakistan CNIC (13-digit Computerized National Identity Card). Normalizes input, checks digit-count/format rules, extracts embedded birth year for 17-digit BD NIDs, and derives gender parity for PK CNICs (last digit odd=male, even=female). No checksum digit is publicly documented for either scheme, so validation is purely structural.
  validatorbangladeshpakistannidcnicidentity
• vat_za_validate
  Offline validator for a South African VAT registration number (SARS 10-digit tax reference number starting with 4). Strips spaces/dashes, checks length and leading digit, and verifies the standard Luhn (mod 10) check digit used by SARS.
  validatorsouth-africavattax-idoffline
• bn_ca_validate
  Offline validator for a Canadian Business Number (BN9) and its extended BN15 form (BN9 + 2-letter program identifier + 4-digit reference number, e.g. 123456782RT0001). Verifies the 9-digit BN via the Luhn checksum algorithm and, if present, decodes the program identifier (RC=Corporate income tax, RT=GST/HST, RP=Payroll, RM=Import/Export, RR=Registered charity, and others) into a human-readable program type.
  validatorcanadabusiness-numbertax-idluhnoffline
• tin_suffix_validate
  Offline structural validator for a generic Tax Identification Number format consisting of an 8-10 digit base number, an optional hyphen, and a 4-digit branch/suffix code (e.g. 01234567-0001). Normalizes input by stripping spaces, checks the digit-count pattern, and returns the parsed base and suffix components. This is a structural check only (no checksum or registry lookup).
  tintax-idvalidatorofflineformat
• bvn_ng_validate
  Offline structural validator for a Nigerian Bank Verification Number (BVN). Normalizes input by stripping spaces/dashes and checks that the result is exactly 11 numeric digits. Does not verify against any live bank registry.
  validatornigeriabvnbankingoffline
• cr_sa_validate
  Offline format validator for a Saudi Arabia Commercial Registration (CR) number: strips spaces/dashes, checks the result is exactly 10 numeric digits with no letters. No check-digit algorithm is publicly documented, so only length/format is verified.
  validatorsaudi-arabiabusiness-idofflineregistration
• vat_sa_validate
  Offline structural validator for a Saudi Arabia ZATCA VAT registration number: normalizes input by stripping spaces/dashes, checks it is exactly 15 digits, and verifies it starts and ends with '3' (the Saudi GCC country code / tax-type marker), matching the documented 15-digit serial+check+subsidiary+taxtype structure. No live check-digit algorithm is publicly documented, so only format validity is confirmed.
  validatorvatsaudi-arabiazatcatax-id
• nid_eg_validate
  Offline validator for an Egyptian National ID (14 digits): parses the century digit (2=1900s, 3=2000s), birth date (YYMMDD), 2-digit governorate code, 4-digit sequence whose last digit encodes gender (odd=male, even=female), and verifies the 14th check digit using the weighted modulus-11 algorithm (weights 2,7,6,5,4,3,2,7,6,5,4,3,2 applied to digits 1-13, mod 11, check = 11 - remainder, with 10/11 mapped to 0). No network access.
  validatoregyptnational-idofflinechecksum
• hp_il_validate
  Offline validator for an Israeli Company Number (ח"פ, 9 digits). Strips non-digit characters, requires exactly 9 digits, applies alternating 1x/2x weights from the left (digit*weight, if product>9 sum its digits), and checks that the total is divisible by 10.
  validatorisraeltax-idcompany-numberoffline
• ice_ma_validate
  Offline validator for a Moroccan ICE (Identifiant Commun de l'Entreprise): parses 15 digits into a 9-digit legal-unit code, 4-digit establishment code and 2-digit control key, then recomputes the control key as 97 minus (first 13 digits mod 97) per the commonly-documented (unofficial, not published by OMPIC) algorithm and compares it to the provided key.
  validatormoroccoicetax-idoffline
• ghana_post_gps_validate
  Offline validator for a GhanaPostGPS digital address (format AA-###-####, e.g. GA-183-9210). Normalizes input (uppercase, trims spaces), checks the pattern, and verifies the two-letter prefix against Ghana's 16 official postal region codes (GA, AK, AH, BA, BE, CR, ER, NE, NR, OT, SV, UE, UW, VR, WR, WN).
  validatorghanapostal-codeaddressoffline
• tin_gh_validate
  Offline structural validator for a Ghanaian GRA legacy Taxpayer Identification Number (TIN): normalizes input (uppercase, strip spaces/dashes) and checks it matches one entity-type prefix letter (e.g. P, C, G, Q, V) followed by exactly 10 digits (11 characters total). Format-check only; no public check-digit algorithm is verified.
  validatortinghanagratax-idoffline
• tin_ph_validate
  Offline structural validator/normalizer for a Philippine TIN (Tax Identification Number). Accepts 9 digits (head office, branch assumed 000) or 12 digits (9-digit base TIN + 3-digit branch code), strips non-digit separators, and returns the normalized XXX-XXX-XXX-XXX form. No checksum is published by BIR, so only digit-count and grouping are validated.
  validatorphilippinestintax-idoffline
• my_number_jp_validate
  Offline format validator for Japan's My Number (Individual Number, 12-digit national ID). Strips non-digit characters, checks length, and verifies the published J-LIS weighted mod-11 check digit algorithm (weights 2-7 then 2-6 applied right-to-left over the first 11 digits). This is a structural/check-digit validation only, not a live registry lookup.
  validatorjapanmy-numbercheck-digitoffline
• csv_to_json
  Parses CSV text into an array of JSON row objects, auto-detecting the delimiter (comma, semicolon, tab, or pipe) unless overridden, inferring per-column types (number, boolean, string, null), and returning a summary with row/column counts and null counts per column. Pure offline computation, no network access.
  csvjsonparserdataoffline
• github_release_commits
  Fetches a GitHub repository's latest release (tag, name, published date, URL) via https://api.github.com/repos/<owner>/<repo>/releases/latest and its 10 most recent commits via https://api.github.com/repos/<owner>/<repo>/commits?per_page=10. Returns release=null if the repo has no releases.
  githubreleasecommitsdevtoolsvcs
• earthquakes_nearby
  Finds earthquakes in the last 24 hours within a given radius of a latitude/longitude point using the USGS FDSN Event API (https://earthquake.usgs.gov/fdsnws/event/1/query?format=geojson). Returns count and a list of events with magnitude, place, time and coordinates.
  earthquakeusgsgeodisasterseismic
• wikipedia_pageviews
  Daily pageview counts for a Wikipedia article over the last N days (default 30) via https://wikimedia.org/api/rest_v1/metrics/pageviews/per-article/{project}/all-access/all-agents/{article}/daily/{start}/{end}. Returns total views and a day-by-day breakdown.
  wikipediapageviewsanalyticswikimedia
• pypi_package_info
  Fetches package metadata from https://pypi.org/pypi/<name>/json and returns the latest version, summary, requires_python, author and project URLs for a given PyPI package name.
  pypipythonpackagemetadata
• x402_payment_decode
  Decodes an x402 'PAYMENT-REQUIRED' style payload (accepts a base64-encoded string or raw JSON) into a readable summary. For each entry in the 'accepts' array it returns scheme, network, asset, payTo, maxTimeoutSeconds, description, resource, mimeType, the raw atomic amount, and priceUsd computed by dividing maxAmountRequired by 10^decimals when the asset matches a known stablecoin contract address (e.g. USDC on Base/Ethereum/Polygon); otherwise decimals/priceUsd are null. Pure offline computation, no network access.
  x402paymentdecodecryptooffline
• x402_check
  Fetches a URL and reports its HTTP status; if the response is 402 Payment Required, parses the JSON body per the x402 protocol and extracts payment requirements (scheme, network, payTo, asset, maxAmountRequired, description, resource) from the 'accepts' array.
  x402paymentshttpcryptovalidation
• base_usdc_eth_balance
  Fetches ETH and USDC balances for an EVM address on Base mainnet via public RPC https://mainnet.base.org, using eth_getBalance and eth_call (balanceOf) on the USDC contract 0x833589fCD6eDb6E08f4c7C32D4f71b54bdA02913.
  blockchainethereumbaseusdcbalancerpc
• edrpou_rnokpp_validate
  Offline validator for Ukrainian EDRPOU (8-digit legal entity registration code) and RNOKPP (10-digit individual taxpayer number, formerly INN) codes. Normalizes input, detects type by length, verifies the official weighted mod-11 check digit algorithm, and returns entity type (legal_entity/individual) plus decoded gender for RNOKPP (from the 9th digit parity).
  validatorukraineedrpournokpptax-idoffline
• fx_rate_history
  Historical daily exchange rates for a currency pair between two ISO dates using https://api.frankfurter.dev/v1/<start>..<end>?base=<base>&symbols=<symbol>. Returns the list of business-day rates in the requested range.
  financecurrencyforexhistory
• air_quality_lookup
  Current air quality (PM2.5, PM10, US AQI, European AQI) for a given latitude/longitude via https://air-quality-api.open-meteo.com/v1/air-quality.
  air-qualityenvironmentweatherpm2.5geolocation
• btc_fee_estimate
  Latest recommended Bitcoin transaction fee rates (sat/vB) for fastest, half-hour, hour, economy and minimum confirmation targets, sourced live from https://mempool.space/api/v1/fees/recommended.
  bitcoinfeesmempoolcryptonetwork
• crypto_pair_stats
  24h trading stats (open, high, low, last price, volume, 30-day volume) for a Coinbase Exchange product pair (e.g. BTC-USD) via https://api.exchange.coinbase.com/products/<pair>/stats.
  cryptocoinbasepricestatsfinance
• human_mirror
  Reflects a writer's communication style from raw text: computes sentiment (positive/negative/neutral) via a small built-in lexicon, tone (formal/informal) by detecting exclamation marks and informal words like 'lol','gonna','wanna','yeah','hey','cool','awesome', plus average word length, average sentence length, and an overall complexity rating (simple/moderate/complex). Pure offline computation, no external calls.
  text-analysissentimentstylewritingnlp
• worldbank_indicator
  Fetches a World Bank development indicator value for a given country and year via https://api.worldbank.org/v2/country/<iso>/indicator/<indicator>?format=json. Returns the country name, indicator name, year and numeric value (or null if unavailable).
  worldbankeconomicsstatisticscountryindicator
• verifactu_hash_compute
  Computes the SHA-256 invoice hash ('huella') for Spain's VERI*FACTU electronic invoicing system per the AEAT technical specification (chaining each invoice to the previous record's hash), and builds the corresponding AEAT QR validation URL. Pure offline computation, no network access required.
  spainverifactutaxinvoicesha256complianceoffline
• api_onesource_io_9dea80
  Latest Ethereum block height - current chain tip via eth_blockNumber
• api_onesource_io_26f6d7
  Ethereum chain ID (EIP-155) via eth_chainId - confirm which chain a network is on
• api_onesource_io_46c2e8
  EVM network info - chain ID, block height, gas price, chain head age, and chain characteristics in one batched RPC call (eth_chainId + eth_blockNumber + eth_gasPrice + latest block header)
• otto_ai_1426bf
  Importance-ranked crypto headlines with per-article source links and publish times, plus a sentiment-scored market brief. Regenerated hourly; meta carries the snapshot's age and a fresh/stale verdict.
  crypto newsmarket newssentiment analysisbreaking headlines
• apitoll_crypto_prices_9a4ce2
  Latest crypto token prices by ticker symbol, CoinGecko id, or chain:address (BTC, ETH, SOL, or base:0x…): current spot price, token symbol, decimals, and a confidence score, for up to 50 coins in one call. Pass ?at=<unix> for the historical price at a point in time. Sourced from DefiLlama across every major chain.
  cryptopricestoken-pricedefimarket-data
• life_advice_3becb5
  Get one piece of thoughtful life advice, paid per request over x402.
  advicelifewisdomtext
• meme_generator_22d8fc
  Generate a captioned meme image. Pay per request in USDC on Base mainnet.
  memeimagegeneratorfun
• coin_flip_64e28d
  Flip a coin for a small USDC payment on Base mainnet. Returns heads or tails.
  gamerandomfun
• useless_fact_304c30
  Pay a tiny amount of USDC and receive one delightfully useless fact.
  factstriviafunuseless
• dice_roller_cd43ca
  Roll a dice with any number of faces. Specify faces via ?faces=N query parameter.
  dicerandomgameutility
• timezone_converter_5ddf11
  Convert a time between any two IANA time zones (DST-aware). Pay-per-call in USDC on Base.
  timetimezoneutilitydatetimeconverter
• otto_ai_346925
  Hyperliquid perpetuals market data: live mark/oracle price, funding rate, open interest, max leverage, and size specs for any tradable asset.
  hyperliquid marketperps market datafunding rateopen interest
• api_loyalspark_online_34e96c
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• vibe_springs_58dd35
  Base network real-time gas price oracle. Returns block base fee, current gas price in GWEI, and network block details.
  priceoraclecryptomarket-database-gas
• hypernatt_terminal_25b5b0
  Forced-order map. If cluster_grammar is present, read it before liq_radar. class=noise (<3%) is high-leverage bait - ignore. class=true (~7%+) is the low-leverage stack. Terrain, not a signal. Whitelist BTC ETH SOL BNB XRP HYPE ZEC (omit = BTC).
  bitcoinhyperliquidtradingmarket makerliquidations
• ixs_9ef8ba
  IXS Real world asset vaults — 6% yields, BlackRock exposure, tokenized on-chain
  rwadefitokenizationerc4626
• otto_ai_572f80
  Token price, market cap, volume, supply, and basic metrics. Works for any listed token.
  token pricemarket captoken metricstoken infoprice data
• otto_ai_f862ed
  Cross-venue funding-rate arbitrage + crowded-positioning radar: live perp funding rates, open interest, global & top-trader long/short ratios, whale positions, and liquidations across Binance, OKX, Bybit, Hyperliquid, and more. Omit symbol for the whole-market overview; pass one (e.g. BTC) for the per-exchange breakdown. (Hyperliquid-only perp data: use hyperliquid-market.)
  funding ratesfunding arbitrageopen interestlong short ratioliquidations
• laso_finance_24fe70
  Get a Firebase ID token for authenticating with the callable APIs
  authsign-inwallet
• apitoll_base_gas_oracle_cfbbec
  Base gas oracle / gas price API for AI agents and bots — get the gas price for a transaction on Base in one x402 call. Real-time slow/standard/fast EIP-1559 fee tiers from a live eth_feeHistory call, returned as DROP-IN maxFeePerGas + maxPriorityFeePerGas in wei — plug straight into a viem/ethers transaction, no gwei conversion. Plus base fee, head block, and network fullness. Call it before every Base tx to set a fair fee or wait out congestion.
  basegasgas-oraclegas-pricetransaction-fees
• exa_abb7a1
  Exa /contents endpoint
  searchaiwebresearch
• otto_ai_683043
  DeFi yield farming markets with live APYs across Aave V3 and Morpho on Base, Ethereum, and other major chains. Find the best stablecoin yield (USDC) and ETH yield for idle capital: returns supply APY, TVL, and vault/market addresses per token, filterable by protocol, chain, or token symbol. Compare DeFi yield rates across lending markets and vaults before depositing.
  yield farmingstablecoin yielddefi yieldaavemorpho
• otto_ai_08b221
  Live + reference foreign-exchange (forex) rates, base USD. LIVE near-real-time mid quotes for the 12 most-traded currencies (EUR, GBP, JPY, CHF, CAD, AUD, NZD, CNY, HKD, SGD, SEK, KRW), refreshed every minute with an honest market-open/stale flag, PLUS the official ECB daily reference table for ~30 currencies. Derive any cross-rate or pair. For agents pricing cross-border ops, treasury, invoicing and FX conversion. Keyless, pay-per-call.
  forexfx ratescurrency exchangelive fxcurrency conversion
• tenprint_b10b00
  Attested Hedera network facts: HBAR exchange rate, gas fees, supply, node roster, throughput, topic state. Each response carries the ML-DSA-65 attestation ID of the served snapshot — tamper-evident reference data for agents that must prove what they knew when they acted.
  hederaoracledata
• quartermaster_gas_prices_b4afbe
  Current Base gas prices and a simple-transfer cost estimate for transaction planning.
  gasfeesbasetransactionsettlement
• api_loyalspark_online_d9080f
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• gedx402_chat_2dc439
  Multi-model chat completions. POST messages[] and set model to any LLM id from GET /v1/models; dynamic USDC pricing scales with model and token usage. Hero: GET /heroes/chat-completions.
  chatopenaicompletionsvenicewinner
• api_loyalspark_online_7c82ba
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• api_loyalspark_online_6be45b
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• api_loyalspark_online_5f8059
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• otto_ai_616c2e
  Where DeFi capital is flowing — TVL rankings, fastest-growing vs bleeding protocols, chain-by-chain breakdown, and per-protocol deep dives. Track capital rotation and protocol health. Powered by DefiLlama.
  defi tvlprotocol analyticsdefi rankingscapital flows
• otto_ai_6d1eeb
  Quick pulse check from crypto Twitter. Breaking news, trending narratives, and sentiment shifts at a glance.
  crypto twittersocial sentimentmarket pulsetweet digest
• lion_verified_company_ce9de4
  Cheapest OFAC SDN wallet screen for AI agents ($0.001). AML/KYT pre-pay gate: PASS/WARN/BLOCK before you settle any x402 counterparty. Keyless Base USDC, Ed25519-attested. Beats $0.005–$0.05 wallet-screen clones. Upsell multi-list sanctions $0.02 + compliance receipt $0.05.
  walletofacamlsanctionsscreen
• otto_ai_2120f4
  Live DEX token price in USD by ticker symbol or contract address across Base, Ethereum, Solana, Polygon, BSC, Arbitrum, Optimism and Avalanche (bare 0x tries Base then all chains, else network:address). Symbols resolve to the canonical top-market-cap asset — squat-proof. Flat JSON: price, 24h change, volume, market cap, FDV, liquidity — echoes the matched deployment. Token price, crypto price, DEX price. $0.001 per call.
  token pricecrypto pricedex priceprice feedonchain price
• apitoll_multi_chain_evm_gas_41bb01
  Multi-chain EVM gas price oracle for AI agents — 17 chains (Ethereum, Base, Arbitrum, Optimism, Polygon, BNB, Avalanche…). One x402 call returns slow/standard/fast EIP-1559 tiers as DROP-IN maxFeePerGas + maxPriorityFeePerGas in wei (plug straight into a viem/ethers tx, no conversion, exact even on sub-gwei L2s), plus base fee, head block, and fullness, from a live eth_feeHistory call. Pass ?chain= to switch chains.
  evmgasmulti-chaingas-oracleethereum
• apitoll_perps_hyperliquid__c97b69
  Perpetual-futures market data from Hyperliquid for any coin (BTC, ETH, SOL, HYPE…): mark price, hourly funding rate and its annualized APR, open interest in coin and USD, 24-hour notional volume, 24h price change, and max leverage, across 200+ perp markets. Sort by volume, open interest, or funding. Track the perp market the way trading agents do. Sourced from Hyperliquid.
  cryptoperpsperpetualsfuturesfunding-rate
• api_loyalspark_online_6dd397
  Onchain loyalty platform on Base Network. Businesses launch branded rewards in minutes, customers earn real value with every purchase, and AI agents automate the rest via REST and MCP. Free plan mints up to 1,000 tokens per month; every call is scoped by row-level security to the wallet behind the API key. 16 skill guides at loyalspark.online/.well-known/skills/index.md.
• json_repair_ba15e0
  Repair malformed JSON text into valid parsed JSON: markdown code fences, single quotes, smart quotes, unquoted keys, trailing commas, comments, Python literals (True/None), raw newlines in strings, and truncated output (auto-closes strings, arrays and objects). Returns the parsed value plus a log of every repair applied. Built for LLM output that almost parses. POST a JSON body like: {"text":"```json\n{name: 'Ada', age: 36, tags: ['x',], active: True"}
  jsonrepairllm-outputsparsingmalformed
• apitoll_crypto_market_overview_fa7668
  A snapshot of the total crypto market: aggregate market capitalization in USD, 24-hour trading volume, Bitcoin and Ethereum dominance percentages, 24h market-cap change, and the number of active cryptocurrencies and markets. The macro view in one call. Sourced from CoinGecko.
  cryptomarket-overviewmarket-capbtc-dominancemacro
• otto_ai_b74dbb
  Base-chain ecosystem news for Base-native agents, not the general crypto firehose. Up to 12 Base-scoped headlines from the last 48h, each with its own permalink and publication timestamp, screened against the general /crypto-news feed; `screen` states what was dropped. The AI topic read is optional and is withheld, never padded with macro, when there is no Base coverage. Refreshed hourly from cache; a read past the freshness window pulls inline.
  basebase ecosystemcrypto newsl2coinbase
• scrapecreators_youtube_channel_profile
  YouTube channel profile by id or username — subscribers. Retrieves comprehensive YouTube channel profile data including name, avatar images, subscriber count, total video and view counts, join date, tags, and linked social accounts. (ScrapeCreators · YouTube)
  youtubesocialscrapecreatorschannelprofiledata
• youtube_youtube_search_videos
  Search YouTube videos by keyword (YouTube · YouTube)
  youtubesocialsearchvideosdata
• youtube_youtube_channel_videos_uploads
  List a channel's videos via its uploads playlist id. List a channel's uploaded videos cheaply, via its uploads playlist (YouTube · YouTube)
  youtubesocialchannelvideosdata
• youtube_youtube_video_comments
  List comments on a YouTube video by video id. List the comments on a YouTube video (any public video, not just your own) (YouTube · YouTube)
  youtubesocialvideocommentsdata
• replicate_image-gen_flux-schnell
  black-forest-labs/flux-schnell. Generate up to four images quickly from a text prompt with the official FLUX Schnell model. (Replicate · Image generation) Async task: answers 202 with a job id; poll GET /v1/jobs/<id>. Price depends on the options ($0.00375 to $0.015); refunded if the task fails. Prepaid credits only.
  image-genai generationreplicateflux-schnellfrom_textasync
• finnhub_quote
  Real-time stock quote by ticker — price, day change. Current price, day change, open/high/low and previous close for a US ticker (Finnhub · Stock Market Data)
  stocksmarket datafinnhubquotelivedata
• scrapecreators_tiktok_video_detail
  TikTok video by URL — engagement stats, transcript. Fetches detailed data for a single TikTok video by URL, including its metadata, engagement stats, and optionally its transcript/captions. (ScrapeCreators · TikTok)
  tiktoksocialscrapecreatorsvideodetaildata
• finnhub_company_profile
  Company profile by stock ticker — industry, market cap. Company behind a ticker: name, industry, market cap, IPO date, logo and weburl (Finnhub · Stock Market Data)
  stocksmarket datafinnhubcompanyprofiledata
• tiingo_daily_prices
  End-of-day stock prices by ticker — adjusted, 30+ years. Daily OHLCV with split/dividend-adjusted values, back 30+ years (Tiingo · Stock Market Data)
  stocksmarket datatiingoeodhistorydata
• seranking_web_backlinks_list
  Backlinks by domain or URL — source page, anchor texts. Individual backlinks to a domain or URL, with source page, anchor and follow status (SE Ranking · Open web & SEO data)
  webseo/aeoserankingbacklinkslistdata
• anyapi_linkedin_search_jobs
  LinkedIn Jobs (index). Cheap job index: title, company, location, posted date, URL. No description, salary, applicant counts, or seniority - for those use linkedin.jobs. (AnyAPI · LinkedIn)
  linkedinsocialanyapisearchjobsdata
• anyapi_google_videos
  Google Videos. Search Google for video results (YouTube and others) with title, link, thumbnail, and source. (AnyAPI · Google Keyword Data)
  googleseo/aeoanyapiextendeddata
• tikhub_x_tiktok-app-v3-fetch-user-post-videos-v3
  TikTok user's videos by secUid or username, simplified. Get user homepage video data V3 (simplified data - faster) (TikHub · TikTok)
  tiktoksocialtikhubuservideosdata
• dataforseo_x_ai-optimization-ai-keyword-data-keywords-search-vol
  AI search volume for keywords across AI tools. This endpoint provides search volume data for your target keywords, reflecting their estimated usage in AI tools. (DataForSEO · AI Visibility / AEO)
  ai-searchseo/aeodataforseokeywordsvolumedata
• anyapi_tiktok_video_transcript_full
  TikTok Video Transcript (Audio). Transcribe the spoken audio of a TikTok video with timed segments, speaker labels, and per-word confidence - for videos TikTok publishes no subtitle track for. (AnyAPI · TikTok)
  tiktoksocialanyapiextendeddata
• tikhub_x_tiktok-web-tiktok-live-room
  TikTok live room danmaku stream by live room URL. Extract live room danmaku (TikHub · TikTok)
  tiktoksocialtikhublivechatdata
• youtube_youtube_video_detail
  YouTube video stats by video id — views, likes, duration. Get a YouTube video's metadata and stats (views, likes, comments, duration) (YouTube · YouTube)
  youtubesocialvideodetaildata
• tomba_web_domain_disposable
  Check email domain status. Domain → two booleans: whether it is a disposable/throwaway mail host and whether it is a free webmail provider — the cheap pre-filter before signup or lead acceptance (Tomba · Open web & SEO data)
  webseo/aeotombadomaindisposabledata
• tinyfish_web_fetch
  Fetch clean page content. Fetch up to ten URLs as Markdown, HTML, or structured JSON, with optional links, metadata, and selectors. (TinyFish · Open web & SEO data)
  webseo/aeotinyfishextractdata
• tinyfish_web_search
  Search the open web. Search the web by keyword or meaning, with domain, language, location, and date filters. (TinyFish · Open web & SEO data)
  webseo/aeotinyfishsearchdata
• tinyfish_web_search_news
  Search recent news. Search TinyFish's news index with optional recency, date, domain, language, and location filters. (TinyFish · Open web & SEO data)
  webseo/aeotinyfishsearchnewsdata
• tinyfish_web_search_publications
  Search research publications. Search research papers by topic, publication year, domain, language, and date. (TinyFish · Open web & SEO data)
  webseo/aeotinyfishsearchpublicationsdata
• leadsforge_linkedin_company_followers_filters_job_titles
  Search follower job-title values. Get paginated list of supported job title values with optional search (LeadsForge · LinkedIn)
  linkedinsocialleadsforgecompanyfollowersfiltersdata
• harvestapi_linkedin_geo_search
  Find LinkedIn location IDs. Search LinkedIn Geo ID by location text (HarvestAPI · LinkedIn)
  linkedinsocialharvestapisearchlocationsdata
• finnhub_company_news
  Company news by stock ticker over a date range. News articles for one company over a date range (Finnhub · Stock Market Data)
  stocksmarket datafinnhubcompanynewsdata
• tiingo_daily_meta
  Ticker metadata by symbol — name, exchange, date range. Name, description, exchange and the date range Tiingo has data for — 30+ years for many tickers (Tiingo · Stock Market Data)
  stocksmarket datatiingocompanyprofiledata
• twelvedata_time-series
  Stock OHLCV time series by symbol — 1min to 1month. OHLCV series at any interval from 1min to 1month — the workhorse for charts and analysis (Twelve Data · Stock Market Data)
  stocksmarket datatwelvedataeodhistorydata
• finnhub_metrics_basic
  Stock fundamentals by ticker — P/E, margins, 52-week range. Valuation, margin, growth and per-share metrics for a ticker (P/E, 52-week range, beta and more) (Finnhub · Stock Market Data)
  stocksmarket datafinnhubfundamentalsmetricsdata
• tiingo_iex_latest
  Latest stock quote by ticker from the IEX feed. The latest top-of-book quote from the IEX feed for a ticker (Tiingo · Stock Market Data)
  stocksmarket datatiingoquotelivedata
• twelvedata_price
  Current price of a symbol — one number only. One number: the current price of a symbol — the cheapest possible check (Twelve Data · Stock Market Data)
  stocksmarket datatwelvedataquotelivedata
• twelvedata_quote
  Stock, forex or crypto quote by symbol — 52-week range. Current quote with open/high/low/close, volume, change and 52-week range — stocks, forex and crypto symbols alike (Twelve Data · Stock Market Data)
  stocksmarket datatwelvedataquotelivedata
• finnhub_symbol_search
  Search stock ticker symbols by company name. Resolve a company name or fragment to tradable symbols (Finnhub · Stock Market Data)
  stocksmarket datafinnhubtickerssearchdata
• twelvedata_symbol_search
  Search stock, forex and crypto symbols by name. Resolve a name or fragment to symbols across stocks, forex and crypto, with exchange info (Twelve Data · Stock Market Data)
  stocksmarket datatwelvedatatickerssearchdata
• tiingo_crypto_prices
  Crypto OHLCV bars by currency pair — 1min to daily. OHLCV bars for crypto pairs (btcusd, ethusd …) at any resample frequency (Tiingo · Crypto Market Data)
  cryptomarket datatiingopricehistorydata
• diffbot_x_nl-process
  Extract entities and sentiment. Runs a pre-trained classifier, named-entity recognizer, sentence tokenizer and sentiment analyzer over submitted text or a URL (Diffbot · Open web & SEO data)
  webseo/aeodiffbotextendeddata
• fishaudio_tts_s2-1-pro
  Fish Audio: S2.1 Pro text to speech. Generate audio from text, optionally using a reusable private voice owned by the current team. (Fish Audio · Voice generation)
  voice-genai generationfishaudios2-1-progeneratedata
• anyapi_twitter_community
  Twitter Community. Fetch a Twitter/X community's public details (name, description, member count, join policy) by URL. (AnyAPI · X (Twitter))
  xsocialanyapiextendeddata
• dataforseo_x_dataforseo-labs-google-historical-serps-live
  Past Google search results for a keyword, by date range. This endpoint will provide you with Google SERPs collected within the specified time frame. (DataForSEO · Google Keyword Data)
  googleseo/aeodataforseoextendeddata
• dataforseo_x_business-data-social-media-pinterest-live
  Pinterest pins made from a list of URLs. Social Media Pinterest API will provide you with data on pins made from the specified URLs. (DataForSEO · Pinterest)
  pinterestsocialdataforseoextendeddata
• dataforseo_web_page_audit
  On-page audit. Crawl one URL on demand — status code, load timings, on-page score, meta and content (DataForSEO · Open web & SEO data)
  webseo/aeodataforseopageauditdata
• litescrape_web_fetch
  Fetch rendered web content. Fetch a public HTTP(S) page and return LLM-ready content (Litescrape · Open web & SEO data)
  webseo/aeolitescrapeextractdata
• litescrape_web_fetch_post
  Web extraction with browser options. Fetch a public HTTP(S) page and return LLM-ready content (Litescrape · Open web & SEO data)
  webseo/aeolitescrapeextractadvanceddata
• litescrape_google_maps_contributor_reviews
  Read a Maps contributor's reviews. Returns the public review history of one Google Maps contributor, up to 200 reviews in one response (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapemapscontributor_reviewsdata
• litescrape_google_maps_photo_metadata
  Get Google Maps photo metadata. Returns the contributor, place, coordinates, type and date of one Google Maps photo (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapemapsphoto_metadatadata
• litescrape_google_maps_popular_times
  Check live Google Maps busyness. Returns popular_times for one place: the live busyness score compared with the usual score for this time, plus the usual hourly curve for each weekday (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapemapspopular_timesdata
• litescrape_google_maps_posts
  Read Google Maps business posts. Returns the posts a business published on Google Maps (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapemapspostsdata
• litescrape_google_maps_reviews
  Read Google Maps reviews. Returns reviews for one place identified by place_id or data_id; Google Maps responses include both, plus a ready-made reviews_link (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapemapsreviewsdata
• litescrape_google_serp_ads
  Find Google Search ads. Returns the Google results page for a query at a named location, including the ads, local_ads, and shopping_results groups when Google serves them (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserpadsdata
• litescrape_google_serp_ai_mode
  Get Google AI Mode answer. Returns the answer Google AI Mode generates for a question, as ordered text blocks, with the sources it cited (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserpai_modedata
• litescrape_google_serp_ai_overview
  Get Google AI Overview. Returns only the AI Overview from a Google results page, and accepts the Google Search parameters except fast_mode (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserpai_overviewdata
• litescrape_google_serp_local
  Search Google Local. Returns Google Local business listings in `local_results`, with ratings, addresses, hours and links when Google shows them (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserplocaldata
• litescrape_google_serp_maps
  Search Google Maps. Search Google Maps with q and type=search to get up to 20 places in local_results, or look up one exact place by place_id, data_cid or data to get place_results (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserpmapsdata
• litescrape_google_serp_organic
  Search Google. Returns a Google results page as JSON: organic results plus every other result group Google served, such as ads, AI Overview, knowledge graph, and local results (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserporganicdata
• litescrape_google_serp_shopping
  Search Google Shopping. Returns the Google Shopping product grid, category blocks, sponsored listings and refinement filters (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeserpshoppingdata
• litescrape_google_shopping_product
  Get a Google Shopping product. Returns one Google Shopping product's merchant offers, specifications, reviews and related products (Litescrape · Google Keyword Data)
  googleseo/aeolitescrapeshoppingproductdata
• litescrape_bing_maps_search
  Search Bing Maps. Searches Bing Maps listings when `q` is supplied, or returns one place's details when `place_id` is supplied; at least one of the two is required (Litescrape · Bing Keyword Data)
  bingseo/aeolitescrapemapssearchdata
• litescrape_bing_serp_organic
  Search Bing. Returns Bing web results: organic results, ads, answer boxes, Knowledge Graph cards, local, shopping, news and related searches when Bing shows them (Litescrape · Bing Keyword Data)
  bingseo/aeolitescrapeserporganicdata
• litescrape_app_store_product
  Get App Store product details. Read app details, version history, screenshots, ratings, privacy disclosures, and related apps (Litescrape · Apple App Store)
  app-storereviews & appslitescrapeproductdata
• litescrape_app_store_reviews
  Read App Store reviews. Read storefront-specific app reviews (Litescrape · Apple App Store)
  app-storereviews & appslitescrapereviewsdata
• litescrape_app_store_search_apps
  Search the Apple App Store. Search iPhone, iPad, and Mac apps or developers by storefront (Litescrape · Apple App Store)
  app-storereviews & appslitescrapesearchappsdata

How to call

https://toll402.dev

Listed in

Directories this entry was found in.