agentsvc.io

Pay-per-call web services for AI agents (70 tools: scraping, screenshots, PDF, OCR, search, news, weather, prices, validation, codes). Paid per request with USDC on Base or Solana via x402. No account or API key.

Skills

• Screenshot API
  Capture any URL as a PNG screenshot. Returns image_base64 (base64 PNG; decode to get raw bytes). Full JS rendering via Playwright, works on SPAs and dynamic content. Params: url (required), width px (default 1280), height px (default 800), full_page boolean, wait_ms.
  visualbrowservisualplaywrightscreenshotpng
• Weather Data
  Current weather plus daily forecast up to 16 days and optional hourly forecast up to 48 hours, worldwide. Current: temperature, feels like, humidity, wind and gusts, precipitation, cloud cover, pressure, conditions text. Daily: min/max, conditions, precipitation sum and probability, max wind, UV index, sunrise/sunset. Params: location (city name like 'Berlin' or 'lat,lon'), days (1 to 16, default 3), hours (0 to 48 hourly steps, default 0), units ('metric' default or 'imperial'). forecast_3d is kept for older clients.
  dataweathergeolocationforecastclimaterealtime
• Currency Exchange Rates
  Live forex rates from European Central Bank (ECB), updated hourly. Returns rates object mapping currency codes to rates relative to base. Pass symbols array to filter (e.g. ['USD','CHF','GBP']). Empty symbols = all 30+ currencies. Use for currency conversion in invoices, pricing, or financial calculations.
  financeforexfinancecurrencyexchangeecb
• HTML to PDF
  Render a URL or raw HTML string to PDF. Returns pdf_base64 (base64 PDF; decode to get raw bytes) and page_count. Provide url OR html, never both. Supports format (A4/Letter/Legal), landscape boolean, and margin settings (top/bottom/left/right in CSS units). Use for invoices, reports, or printable document generation.
  visualpdfbrowserdocumentplaywrightconvert
• IP Geolocation
  Resolve any IPv4 or IPv6 address to location and network data. Returns country, country_code, city, region, postal, lat/lon, timezone, ISP, org, and ASN. Use for fraud detection, geolocation enrichment, or access log analysis.
  utilityipgeolocationnetworkisptimezone
• Webpage Reader
  Read ONE JavaScript-heavy page (single-page apps, dashboards, content loaded after page load) in a real Chromium browser and get the rendered text with title, description, word_count and optional links. Slower and pricier than web-scrape: use it only when web-scrape returns little or no content. Params: url (required), include_links, max_chars (default 8000).
  webwebscraperreadertextplaywrightextractresearch
• DNS Lookup
  Resolve DNS records for any domain. Supports A, AAAA, MX, TXT, CNAME, NS. Returns records object with array per type. Default: A records only. Use to verify mail server setup (MX), check domain ownership (TXT), or debug DNS propagation.
  utilitydnsnetworkdomainlookupAMXTXT
• QR Code Generator
  Generate a QR code for any text or URL. Returns image_base64 (base64 PNG; decode to get raw bytes). Params: text (required), size in px (64-1024, default 256), error_correction (L/M/Q/H, default M). H = highest redundancy, survives up to 30% damage.
  utilityqrqrcodeimageencodepngbarcode
• Web Search
  Quick factual lookup: a plain-language summary (abstract) plus up to 5 relevant links from DuckDuckGo instant answers and Wikipedia. Best for people, places, concepts, history and science. Returns links, not page content: to get the content of the top results in the same call, use search-read. Not for breaking news: use news-search. Params: query (required).
  websearchwebduckduckgoresearchqueryinformation
• Text Translation
  Translate text between 100+ languages. Max 500 characters per call. Returns translated_text and confidence (0-1). Set target_lang to IETF code: 'de' (German), 'fr' (French), 'es' (Spanish), 'ja' (Japanese), 'zh-CN' (Chinese Simplified), 'ar' (Arabic), 'pt' (Portuguese), 'it' (Italian), 'nl' (Dutch). source_lang defaults to auto-detect.
  texttranslatelanguagenlptextmultilinguali18n
• Email Validation
  Validate an email address: RFC 5322 format check, domain MX record lookup, disposable provider detection, and role address detection (e.g. info@, admin@). Returns is_valid boolean and granular checks object. Use before storing or sending to email addresses to prevent bounces.
  utilityemailvalidationmxdeliverabilityspamverification
• SSL Certificate Check
  Inspect SSL/TLS certificate for any domain. Returns valid boolean, days_remaining, issuer, valid_from, valid_to, subject_alt_names (SANs), fingerprint_sha256, and protocol version. Default port 443. Use for certificate expiry monitoring, security audits, or HTTPS verification.
  utilityssltlscertificatesecurityhttpsexpirymonitoring
• WHOIS Lookup
  Domain registration lookup via RDAP (modern WHOIS). Returns registrar, registrar_url, created_at, updated_at, expires_at, days_until_expiry, name_servers array, status array, and registrant_country. Clean JSON, no raw WHOIS text to parse. Covers all major TLDs.
  utilitywhoisrdapdomainregistrardnsexpiryregistration
• Crypto Price Lookup
  Crypto prices in USD and other currencies. Three modes: (1) coins as CoinGecko IDs or tickers (up to 50) for live price, 24h change and market cap in the requested currencies; (2) tokens as chain:address (e.g. base:0x833589fC…, ethereum:0x6982…) for any DEX-traded token; (3) at (past ISO date or unix seconds) for historical USD prices of coins and tokens. Params: coins, tokens, currencies (default ['usd']), at.
  financecryptobitcoinethereumpricesfinancedeficoingeckomarket
• PDF Text Extraction
  Extract all text from a PDF. Send as pdf_base64 (base64-encoded PDF, max ~10 MB decoded). Returns text (full concatenated text), pages array (per-page text + char_count), page_count, and metadata (title, author, creator). Encode with: Buffer.from(pdfBytes).toString('base64'). Ideal for RAG pipelines, document QA, or LLM ingestion.
  textpdftextextractparsedocumentocrragllm
• Phone Number Validation
  Parse and validate any phone number worldwide using libphonenumber. Returns is_valid, e164 (canonical international format e.g. '+4917612345678'), national_format, country_code (ISO alpha-2), and line_type (MOBILE/FIXED_LINE/VOIP/TOLL_FREE). Provide country_code hint (e.g. 'DE') for local numbers without country prefix.
  utilityphonevalidationmobilelandlinee164internationalcarrier
• Stock Price Lookup
  Real-time stock data via Yahoo Finance. Returns price, change, change_pct, previous_close, market_cap, pe_ratio, week_52_high, week_52_low, volume, and market_state. Max 10 symbols per call. Non-US exchange suffixes: 'SAP.DE' (Xetra), 'VOD.L' (London LSE), 'AIR.PA' (Paris Euronext), 'ASML.AS' (Amsterdam).
  financestocksfinancenasdaqnysesharesmarkettradingequities
• Geocoding
  Forward geocoding: address string → lat/lon. Reverse geocoding: lat/lon → human-readable address. Powered by OpenStreetMap Nominatim. Returns results array with display_name, lat, lon, type, and structured address object. Provide address (string) for forward, or lat + lon (numbers) for reverse.
  utilitygeocodinggeolocationaddresscoordinateslatlonmapsopenstreetmap
• News Search
  Recent news articles by keyword with title, url, source, published_at and snippet, from Hacker News (tech) and BBC feeds (general, world, business, science, health, politics). Use for current events and topic monitoring. For crypto news use crypto-news, for what people say about a topic discussion-search, and for full article text pass the URLs to web-read-batch. Params: query (required), limit (max 30), category.
  webnewssearcharticlesheadlinesrsshackernewsbbcmedia
• OCR: Image to Text
  Extract text from images using Tesseract OCR. Send image as image_base64 (PNG/JPEG/WebP/TIFF/BMP, max 10 MB decoded). Returns text and confidence (0-100, where 80+ is reliable). Set language to Tesseract code: 'eng' (default), 'deu' (German), 'fra' (French), 'chi_sim' (Chinese Simplified), 'jpn' (Japanese), 'ara' (Arabic). Use for invoices, receipts, scanned documents, or screenshots with text.
  textocrimagetextextracttesseractscandocumentinvoicereceipt
• Web Scrape (URL to Markdown)
  Default tool for reading ONE web page whose URL you have: returns clean Markdown (title, meta description, main content with headings, lists and links). The fastest and cheapest way to give an LLM the content of a page. If a JavaScript app comes back nearly empty, set render:true (real browser, slower, plain text) or use webpage-reader. For 2 to 5 URLs use web-read-batch, for a whole site site-crawl, and if you have a question but no URL search-read. Params: url (required), max_chars (default 8000, max 60000), include_links, render.
  webscrapemarkdowncrawlhtmlreaderllmcontentweb
• RSS / Atom Feed to JSON
  Fetch an RSS 2.0, RSS 1.0 or Atom feed and return normalized JSON items (title, link, published_at ISO 8601, summary without HTML, author, guid). Use for monitoring blogs, news sites, GitHub releases, podcasts or any feed URL without writing an XML parser. Params: url (required), limit (default 20, max 100).
  webrssatomfeednewsmonitorxmljson
• URL Status & Redirect Check
  Check whether a URL is reachable and what it returns: final status code, full redirect chain, response time, content-type, server header and content length. Use for link validation, uptime checks, canonical URL resolution or before spending money on a scrape/screenshot. Params: url (required), method (GET default, or HEAD).
  utilityhttpstatusredirectuptimelinkcheckmonitor
• Wallet Balance on Base
  Read the ETH and USDC balance of any address on Base mainnet (chain 8453) straight from the chain, plus transaction count and how many x402 calls the USDC covers. Use it to check your own agent wallet before a paid workflow, to verify a counterparty was paid, or to monitor treasury addresses. Params: address (required, 0x...).
  financewalletbalanceusdcethbaseonchaincryptox402
• Barcode Generator
  Generate a barcode as PNG (base64): code128 (default), ean13, ean8, upca, upce, code39, itf14, gs1_128, isbn, datamatrix, pdf417, aztec or qr. Validates check digits for EAN/UPC. Use for labels, shipping, inventory, tickets or invoices. Params: text (required), type, scale (1-8, default 3), include_text boolean (human-readable text under the bars).
  utilitybarcodeeancode128pnglabelgeneratedatamatrixpdf417
• Image Resize & Convert
  Resize, crop-fit and convert images (PNG, JPEG, WebP, AVIF, GIF, TIFF, SVG input) to webp, png, jpeg or avif. Auto-rotates by EXIF. Use to shrink screenshots before sending them to a vision model, create thumbnails, or convert formats. Params: image_base64 or image_url (one required), width, height (max 4096), fit (inside default | cover | contain | fill), format (webp default), quality (1-100, default 80).
  visualimageresizethumbnailwebpconvertcompresssharp
• Timezone & Local Time
  Resolve a city name or coordinates to its IANA timezone and return the current local time, UTC offset, DST flag and weekday. Use for scheduling across regions, 'what time is it in X', or normalizing timestamps. Params: location (required, e.g. 'Tokyo' or '35.68,139.69').
  datatimezonetimeclockutcdstscheduleiana
• Web Read Batch
  Read 2 to 5 pages whose URLs you already know in one call, each as clean Markdown with title and description, fetched in parallel. Cheaper and faster than calling web-scrape once per URL. A failed page is reported with its error while the others still return; charged only if at least one page was read. To find URLs first, use site-map (one site) or search-read (a question). Params: urls (1 to 5, required), max_chars per page (500 to 30000, default 6000).
  webscrapemarkdownbatchwebreader
• Prediction Markets (Polymarket)
  Live Polymarket prediction markets: outcome probabilities, 24h volume, liquidity, 24h price change and end date. Search by topic (query, e.g. 'bitcoin', 'election', 'fed rate') or omit query to get the markets with the highest 24h volume. Only open markets. Params: query (optional), limit (1 to 25, default 10).
  financepolymarketprediction-marketsoddsprobabilityforecast
• Hyperliquid Perps Data
  Hyperliquid perpetual futures market data: mark and oracle price, 24h change, hourly funding rate and funding APR, open interest (coins and USD), 24h volume, max leverage. Pass coins (e.g. ['BTC','ETH','SOL']) or omit them to get the top markets by open interest. Params: coins (optional, max 50), limit (1 to 50, default 10, used without coins).
  financehyperliquidperpsfunding-rateopen-interestcrypto
• DeFi Yields
  Find DeFi yield pools across 400+ protocols and 100+ chains (DefiLlama data): APY split into base and reward, 30-day mean APY, 7-day APY change, TVL, stablecoin flag, impermanent-loss risk. Filter by chain (e.g. 'Base', 'Ethereum'), project (e.g. 'aave'), token symbol (e.g. 'USDC'), stablecoin_only, min_tvl_usd (default 1,000,000); sort by 'apy' (default) or 'tvl'. Outliers (flagged by DefiLlama or above 500% APY) are excluded unless include_outliers is true.
  financedefiyieldapytvldefillama
• ERC20 Token Info
  Read an ERC20 token contract on Base or Ethereum mainnet: name, symbol, decimals, total supply, and optionally the balance of one holder address. Verifies that the address is a contract. Params: token (contract address, required), chain ('base' default or 'ethereum'), holder (optional address).
  dataerc20tokenbaseethereumonchain
• EVM Transaction Status
  Look up a transaction on Base or Ethereum mainnet: status (success, failed, pending or not_found), block, confirmations, timestamp, from, to, ETH value, gas used, fee, method id and decoded ERC20 transfers with symbols and amounts. Useful to confirm that a payment arrived. Params: hash (0x transaction hash, required), chain ('base' default or 'ethereum').
  datatransactionreceiptbaseethereumonchain
• Public Holidays
  Public and bank holidays for 200+ countries and their regions (states, cantons) for any year, with local names. Optionally check whether a given date is a holiday. Params: country (ISO 3166-1 alpha-2, required, e.g. DE, US, CH, JP), region (e.g. BY, CA, ZH), year (default current), date (YYYY-MM-DD to check), language (e.g. en), include_observances (default false).
  dataholidayscalendarbusiness-dayspublic-holidaydates
• EU VAT Number Validation (VIES)
  Validate an EU VAT identification number live against the official EU VIES service, with registered company name and address where the member state discloses them. Checks the national format first. Not charged if the member state service is temporarily unavailable. Params: vat_number (with country prefix, e.g. NL004495445B01, DE811569869) or vat_number + country_code.
  utilityvatviestaxkybeu
• IBAN Validation
  Validate an IBAN (checksum, country length and structure), split it into bank code, branch and account number, report SEPA membership, and for DE, AT, CH, NL, BE, LU and LI add bank name, BIC and city. Params: iban (required, spaces allowed).
  utilityibanbicbanksepapayments
• Company Lookup (LEI)
  Find companies worldwide in the Global LEI Index (GLEIF): legal name, LEI, jurisdiction, legal form, register number and authority, legal and headquarters address, status and founding date. Search by name (optionally filtered by country) or fetch one LEI. Params: name or lei (one required), country (ISO2), limit (1 to 20, default 5).
  datacompanyleikybregistrybusiness
• SEC Filings (EDGAR)
  US public company data from SEC EDGAR: company profile, recent filings (10-K, 10-Q, 8-K, Form 4 insider trades, S-1 ...) with direct document links, and optionally the latest annual financials (revenue, net income, assets, liabilities, equity, operating cash flow, diluted EPS). Params: ticker or cik (one required), forms (filter, e.g. ['10-K','8-K']), limit (1 to 50, default 10), include_financials (default false).
  financesecedgar10-kfilingsstocks
• Gas Prices (multi-chain)
  Current gas prices on Ethereum, Base, Arbitrum, Optimism, Polygon, BNB Chain and Avalanche: gas price, base fee, low/medium/high priority fee in gwei, native token USD price and estimated USD cost of an ETH transfer, ERC20 transfer and swap. Params: chains (optional list, default all).
  financegasfeesevmbaseethereum
• Product Lookup by Barcode
  Look up a product by EAN/UPC barcode in Open Food Facts, Open Beauty Facts and Open Products Facts: name, brand, quantity, categories, ingredients, allergens, labels, nutrition per 100 g, Nutri-Score, NOVA group and image URL. Params: barcode (8 to 14 digits, required).
  databarcodeeanproductnutritionfood
• Language Detection
  Detect the language of a text (80+ languages) with ISO 639-1 and 639-3 codes, confidence, a reliability flag and the top candidates. Runs locally, nothing is stored. Params: text (required, up to 20,000 characters), top (number of candidates, default 3).
  textlanguagedetectnlpiso639text
• User-Agent Parser
  Parse a User-Agent string into browser, engine, OS, device type/vendor/model and CPU, and flag bots and AI crawlers (GPTBot, ClaudeBot, PerplexityBot ...). Params: user_agent (required).
  utilityuser-agentbrowserdevicebot-detectionanalytics
• Macroeconomic Data
  Macroeconomic indicators per country from World Bank Open Data with yearly history: inflation, GDP, GDP growth, GDP per capita, unemployment, population, government debt, current account, exports, lending rate. Optionally current ECB policy rates. Params: country (ISO2 or ISO3, required), indicators (default inflation, gdp, gdp_growth, unemployment, population), years (1 to 20, default 5), include_ecb_rates (default false).
  financemacroinflationgdpeconomyworld-bank
• Sanctions Screening (OFAC, EU, UN)
  Screen a person or company name against the official OFAC SDN list (with aliases), the EU consolidated financial sanctions list and the UN Security Council consolidated list. Fuzzy, word-order independent matching with scores, list, program and aliases. Lists refresh every 12 hours. A screening aid, not a legal determination. Params: name (required), type ('individual' or 'entity', optional), threshold (0.5 to 1, default 0.85), limit (default 10).
  datasanctionsofaccompliancekycaml
• Site Map (URL discovery)
  List the URLs of a website without reading them: robots.txt, sitemaps and sitemap indexes plus homepage links, up to 1,000 same-site URLs with lastmod and source. A cheap first step to decide which pages to read with web-read-batch or site-crawl. Returns no page content. Params: url (site or domain, required), max_urls (1 to 1000, default 200).
  websitemapcrawlurlsseoweb
• Site Crawl to Markdown
  Read a whole website or one section of it (for example every page under /docs) as clean Markdown: starts at a URL, follows same-site links breadth-first and returns up to 20 pages with title and description. Use for documentation, product catalogs or company sites. For one page use web-scrape, for a known list of URLs web-read-batch. Charged only if at least one page was read. Params: url (required), max_pages (1 to 20, default 5), max_chars per page (500 to 20000, default 4000), path_prefix (e.g. /docs).
  webcrawlmarkdownragscrapeweb
• Email Deliverability Verification (SMTP)
  Checks whether an email address really exists by asking its mail server (SMTP RCPT TO probe; no email is sent), on top of syntax, MX, disposable and role checks. Returns status deliverable, undeliverable (mailbox does not exist), catch_all (domain accepts any address), risky (disposable or mailbox full) or unknown (greylisting, server refused the check), plus the raw SMTP reply. Use it before sending outreach, to clean lead lists or to block fake sign-ups. Results are cached 6 hours. Params: email (required).
  utilityemailemail-verificationdeliverabilitysmtpleadvalidationbounce
• Token Risk & Honeypot Check
  Risk check with grade A to F for a token before buying or accepting it, on Solana (SPL and Token-2022) and on Base, Ethereum, BNB Chain, Arbitrum or Polygon. Returns a verdict (low, medium, high, critical, or incomplete if the security feed is down), a one-sentence summary ready to show a user, and concrete flags. EVM: honeypot simulation, buy/sell tax, mintable, owner can change balances, hidden owner, blacklist, pausable transfers, proxy, unverified source, holder concentration, LP lock. Solana: freeze authority (the Solana honeypot pattern), mint authority, permanent delegate, transfer hook, transfer fee, non-transferable, frozen default state, malicious authorities, holder concentration. Both: DEX liquidity, pair age, 24h volume and price. Sources: GoPlus Security, DexScreener, on-chain RPC. Params: token (EVM contract address or Solana mint, required), chain (base default, solana, ethereum, bsc, arbitrum, polygon; a base58 mint is detected as Solana automatically).
  financetoken-securityhoneypotrug-checkerc20defisolana
• Perp Funding Rates (multi-venue)
  Perpetual futures funding rates for up to 10 coins across Binance, Bybit, OKX and Hyperliquid in one call: funding rate per interval, interval hours, annualized APR, mark price, open interest in USD and next funding time per venue, plus average APR, total open interest, max/min venue and the funding spread as an arbitrage hint. Venues that are unreachable or do not list a coin are reported per venue. Params: coins (default BTC, ETH, SOL), venues (default all).
  financefunding-rateperpsopen-interestarbitragecrypto
• DeFi TVL and DEX Volume
  DeFi data from DefiLlama in four modes. protocol: TVL, 1d/7d change, category, market cap and chain breakdown of a protocol (slug or name, e.g. aave, uniswap, lido). top: largest protocols by TVL, optional category (e.g. Lending, Dexs, Liquid Staking) and chain filter. chains: chains ranked by TVL with share. dex_volume: 24h/7d/30d DEX volume and top DEXes, optionally for one chain. Params: mode (protocol, top, chains, dex_volume; default top, or protocol if protocol is given), protocol, category, chain, limit (1 to 50, default 10).
  financedefitvldex-volumedefillamaprotocols
• Crypto News (ranked)
  Latest crypto news from CoinDesk, Cointelegraph, Decrypt, The Block and Bitcoin Magazine, merged and ranked: the same story covered by several outlets is grouped and ranked higher, newer stories rank higher. Each article has title, source, URL, publish time, 300-character summary, mentioned tickers and which outlets covered it. Filter by coins (tickers) or keywords. Params: coins (e.g. ['BTC','ETH']), query (keywords), hours (lookback 1 to 168, default 48), limit (1 to 50, default 20), sources.
  financecrypto-newsnewsbitcoinethereumrss
• Search and Read
  Answer a question from the web when you have no URL yet: runs a web or news search and returns the top 1 to 5 result pages already read as clean Markdown, with title, URL and snippet. Replaces one search call plus several page reads. If links and a short summary are enough, web-search is cheaper. Charged only if at least one page was read. Params: query (required), source ('web' default or 'news'), count (1 to 5, default 3), max_chars per page (500 to 20000, default 4000).
  websearchreadmarkdownragweb
• Scientific Paper Search
  Search scientific papers across OpenAlex (250M works, all fields), arXiv (preprints) and PubMed (biomedicine) in one call. Returns title, up to 5 authors, year, venue, DOI, landing URL, open-access PDF URL, citation count and abstract (up to 600 chars), merged and deduplicated by DOI. Params: query (required), source ('all' default, 'openalex', 'arxiv', 'pubmed'), limit (1 to 25, default 10), year_from, open_access_only (default false).
  datapapersresearcharxivpubmedopenalex
• Developer Search
  Search developer sources in one call: Hacker News stories (Algolia), GitHub repositories (by stars), npm packages (with weekly downloads), PyPI (exact package lookup, PyPI has no search API) and Stack Overflow questions. Each source returns its own list; a source that is rate limited reports an error without failing the call. Params: query (required), sources (default all: hackernews, github, npm, pypi, stackoverflow), limit per source (1 to 20, default 5).
  webgithubnpmhackernewsstackoverflowdeveloper
• Trending Now (hot lists)
  What is trending right now: Hacker News top stories, GitHub trending repositories (stars today/week/month), most-read Wikipedia articles (any language edition), Google News top stories per country, Baidu realtime hot searches and Bilibili popular videos (China). Each item has rank, title, url and a score (points, stars, pageviews, heat, views). Params: sources (default all), limit per source (1 to 50, default 10), language (Wikipedia and Google News, default en), country (Google News, default US), since (GitHub: daily, weekly, monthly).
  datatrendingnewshot-listsocialchina
• CVE and Package Vulnerability Lookup
  Look up a vulnerability by CVE or GHSA id (NVD: description, CVSS score and vector, CWE, CISA known-exploited flag; OSV: affected packages and fixed versions) or check a package version for known vulnerabilities via OSV.dev (npm, PyPI, Maven, Go, crates.io, RubyGems, NuGet, Packagist, Debian ...). Params: cve_id, or package + ecosystem (+ version, recommended), limit (default 20).
  utilitycvesecurityvulnerabilityosvdependencies
• Domain and Email Security Check
  Check a domain in one call: registration via RDAP (registered or likely available, registrar, created and expiry dates, status, nameservers; DNS fallback for TLDs without RDAP), DNS (A, NS, MX, CAA, DNSSEC) and email security (SPF, DMARC policy, DKIM on common selectors) with a 0 to 100 score, grade and findings. Params: domain (required).
  utilitydomainrdapdmarcspfavailability
• VIN Decoder
  Decode a 17-character vehicle identification number with NHTSA vPIC: make, model, model year, trim, body, doors, engine (cylinders, displacement, hp, fuel, electrification), drive, transmission, manufacturer and plant. Validates format and the check digit (mandatory for North American VINs). Best coverage for vehicles sold in the US. Params: vin (required).
  datavinvehiclecarnhtsaautomotive
• Postal Code Lookup
  Postal codes for 70 countries (GeoNames via zippopotam.us): postal code to place names, state and coordinates, or city + state to all its postal codes. For GB, CA and IE only the outward part (e.g. SW1A) is resolved. Params: country (ISO2, required), postal_code, or city + state (state abbreviation, e.g. CA, BY).
  datapostal-codezipgeocodingaddressplaces
• US Airport Status (FAA)
  Live US airport disruptions from the FAA National Airspace System status: ground stops, ground delay programs (average and max delay), arrival and departure delays with trend, and closures. Pass airports (IATA like JFK or ICAO like KJFK) for a per-airport status (normal, delays, disrupted; general-aviation-only closures are listed as notices) or omit them to get all current events. US airports only. Params: airports (optional list).
  dataairportflightsdelaysfaatravel
• Satellite Image (NASA)
  Daily true-color satellite image of any area from NASA GIBS (MODIS Terra/Aqua or VIIRS, about 250 m per pixel, coastlines overlaid) as base64 JPEG. Useful to see clouds, smoke, snow, floods or fires on a given day. Params: bbox [min_lat, min_lon, max_lat, max_lon] or lat + lon + radius_km (5 to 500, default 50), date (YYYY-MM-DD, default yesterday), layer (modis_terra default, modis_aqua, viirs_snpp, viirs_noaa20), width (64 to 1024, default 512), height (default from aspect).
  visualsatellitenasaearthimageryweather
• Chart Rendering (Chart.js)
  Render a chart to PNG from JSON: bar, line, pie, doughnut, scatter, radar, polarArea or bubble. Pass a full Chart.js config (config) or the shortcut type + labels + datasets [{label, data}] + title. Rendered with Chart.js in headless Chromium, no external requests. Params: config or type/labels/datasets, title, width and height (100 to 2000 px, default 800x500), background (CSS color, default white). Returns image_base64 (PNG).
  visualchartgraphvisualizationpngchartjs
• Diagram Rendering (Mermaid)
  Render Mermaid diagram code to SVG and/or PNG: flowchart, sequence, class, state, ER, gantt, pie, mindmap, timeline and more. Invalid syntax returns HTTP 400 with the Mermaid parse error (not charged), so an agent can fix and retry. Params: code (Mermaid source, required), format (svg default, png or both), theme (default, dark, neutral, forest, base), width (200 to 4000, default 1200), background.
  visualmermaiddiagramflowchartsvgvisualization
• Document Conversion (pandoc)
  Convert documents between formats with pandoc: Markdown, HTML, DOCX, ODT, EPUB, RST, LaTeX, RTF, plain text and PDF. Input as text (content), file (file_base64, max 10 MB: docx, odt, epub, rtf) or url. Input format is detected automatically or set with from. Text outputs come back as content, binary outputs (docx, odt, epub, pdf) as file_base64. Local file includes and remote images are not loaded. Params: to (required), content or file_base64 or url, from, title.
  textconvertpandocdocxmarkdownpdf
• Document to Markdown (parse)
  Turn a document into clean, agent-ready Markdown with metadata: DOCX, ODT, EPUB, RTF, HTML, RST, LaTeX and more. Returns title, author, date, language, word count, heading outline, table and image counts and the Markdown (headings and tables preserved). For PDF use pdf-extract; PPTX and XLSX are not supported. Params: file_base64 or url or content (one required), from (optional), max_chars (1000 to 200000, default 50000).
  textparsedocxmarkdownextractdocument
• Website Technology Detection
  Detect the technologies a website uses (CMS, frameworks, analytics, CDN, web server, ecommerce, tag managers ...) from its HTML, headers, cookies, meta tags and script URLs, matched against 7,600+ open webappanalyzer fingerprints. Returns name, categories, version where visible, confidence and evidence, plus a by-category summary. Params: url (required), min_confidence (0 to 100, default 50).
  webtechnologywappalyzercmswebsiteleads
• Text Embeddings and Rerank
  Sentence embeddings (all-MiniLM-L6-v2, 384 dimensions, L2-normalized, multilingual input works best in English) for semantic search, clustering and deduplication, or rerank mode: pass query + documents to get documents sorted by cosine similarity. Runs locally, texts are not stored. Params: texts (1 to 32 strings, max 2000 chars each) for embed mode, or query + documents (up to 64) and top_k for rerank mode.
  textembeddingsreranksemantic-searchvectorrag
• Text to Speech
  Convert text to natural speech audio (MP3, WAV or OGG) with neural Piper voices: en-female, en-male (US English) and de-male (German); all voices public domain or CC0, so the audio can be used commercially. Params: text (required, max 2000 characters), voice (default en-female, or picked from language), language (en or de), speed (0.5 to 2, default 1), format (mp3 default, wav, ogg). Returns audio_base64 and duration.
  textttsspeechaudiovoicemp3
• Discussion Search (HN, Bluesky, Lemmy)
  Find out what people say about a topic or a specific link. Searches Hacker News (stories with their top-ranked comments), Bluesky posts and Lemmy threads (with top comments) in one call, by keywords or by URL (finds every thread that shared that link, useful for product launches, articles and competitors). Each thread has title, text snippet, linked URL, discussion URL, author, points, comment count, date and up to 5 top comments; a summary gives total threads, points, comments and the most discussed thread. A source that is down reports an error without failing the call. Reddit and X are not included. Params: query or url (one required), sources (default all: hackernews, bluesky, lemmy), sort ('top' default or 'recent'), days (lookback 1 to 3650, optional), limit per source (1 to 20, default 5), comments per thread (0 to 5, default 2).
  webhackernewsblueskylemmysocialdiscussionssentimentcommentssocial-listening
• Token Verdict (grade A to F)
  Instant buy-or-avoid verdict for a token: send a contract address (Base, Ethereum, BSC, Arbitrum, Polygon) or a Solana mint, get a grade A to F, a label (SAFE, CAUTION, RISKY, DANGER), a 0 to 100 score and a one-line reason, built from real checks: honeypot sell simulation, buy and sell tax, mint, freeze and owner powers, holder concentration, DEX liquidity and token age. Young or illiquid tokens can never grade above C. Also returns key facts and a share_text. Params: token (address; tokenAddress also accepted), chain (default base; solana auto-detected).
  financecryptotokenrug-checkhoneypotscam-checkverdictsolanabasedefi

How to call

https://agentsvc.io/api/v1/proxy

Listed in

Directories this entry was found in.